EPCR Protein, Mouse (HEK293, hFc)
EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EPCR Protein, crucial in the protein C pathway, regulates blood coagulation by binding and enhancing the activation of activated protein C through the thrombin-thrombomodulin complex, ensuring effective control of hemostasis.EPCR Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived EPCR protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The EPCR protein plays a crucial role in the protein C pathway, which regulates blood coagulation. It has the capability to bind activated protein C and acts to enhance its activation by the thrombin-thrombomodulin complex. This interaction is essential for controlling blood coagulation and maintaining proper hemostasis.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q64695 (L18-S214)
-
Molecular Construction
-
N-term
-
EPCR (L18-S214)
Accession # Q64695 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PROCR; Protein C Receptor, Endothelial; Protein C Receptor; CD201 Antigen; EPCR; APC Receptor; Endothelial Protein C Receptor; CD201; Activated Protein C Receptor; Cell Cycle, Centrosome-Associated Protein; CCD41; Centrocyclin; Endothelial Cell Protein C
-
AA Sequence
LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS
-
Predicted Molecular Mass
49.3 kDa
-
Molecular Weight
Approximately 65-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
