EphA7 Protein, Human (Active, sf9, His-GST)
The EphA7 protein is a receptor tyrosine kinase that promiscuously binds to the GPI-anchored ephrin-A ligand to initiate bidirectional signaling. It participates in forward and reverse signaling pathways, uses EFNA5 as a functional ligand, regulates brain development and affects cell adhesion and repulsion. EphA7, Human (Active, sf9, His-GST) is the recombinant human-derived EphA7 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The EphA7 protein is a receptor tyrosine kinase that promiscuously binds to the GPI-anchored ephrin-A ligand to initiate bidirectional signaling. It participates in forward and reverse signaling pathways, uses EFNA5 as a functional ligand, regulates brain development and affects cell adhesion and repulsion. EphA7, Human (Active, sf9, His-GST) is the recombinant human-derived EphA7 protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
The EphA7 protein, a receptor tyrosine kinase, engages in promiscuous binding to GPI-anchored ephrin-A family ligands on adjacent cells, initiating contact-dependent bidirectional signaling. The downstream pathway originating from the receptor is termed forward signaling, while the pathway downstream of the ephrin ligand is referred to as reverse signaling. Among the GPI-anchored ephrin-A ligands, EFNA5 serves as a cognate/functional ligand for EPHA7, regulating brain development and modulating cell-cell adhesion and repulsion. EphA7 exhibits repellent activity on axons, playing a crucial role in guiding corticothalamic axons and ensuring the proper topographic mapping of retinal axons to the colliculus. Additionally, EphA7 may contribute to brain development through a caspase (CASP3)-dependent proapoptotic activity. Forward signaling through EphA7 may result in the activation of components of the ERK signaling pathway, including MAP2K1, MAP2K2, MAPK1, and MAPK3, which are phosphorylated upon EphA7 activation.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q15375-1 (R580-V998)
-
Gene ID2045
-
Molecular Construction
-
N-term
-
His-GST
-
(R580-V998)
Accession # Q15375-1 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
EPHA7; EK11; EPH Receptor A7; Receptor Protein-Tyrosine Kinase HEK11; Ephrin Type-A Receptor 7; Tyrosine-Protein Kinase Receptor EHK-3; EPH Homology Kinase 3; Receptor Protein-Tyrosine Kinase; Hek11; Alternative Protein EPHA7; EPH-Like Kinase 11; Eph Homo
-
AA Sequence
RRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)