Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Ephrin-A4/EFNA4 proteins are cell surface GPI-binding ligands of Eph receptors that serve as critical mediators in a variety of cellular processes critical for migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. As a promiscuous binder, Ephrin-A4 binds to Eph receptors on neighboring cells, stimulating contact-dependent bidirectional signaling to neighboring cells. Ephrin-A4/EFNA4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-His labeled tag.
Background
Ephrin-A4 (EFNA4) is a cell surface glycosylphosphatidylinositol (GPI)-bound ligand that belongs to the Eph receptor family, a group of receptor tyrosine kinases crucial for various developmental processes, including migration, repulsion, and adhesion in neurons, vascular tissues, and epithelial cells. EFNA4 binds promiscuously to Eph receptors on adjacent cells, initiating contact-dependent bidirectional signaling into neighboring cells. This interaction is essential for orchestrating complex cellular events during development. Moreover, EFNA4 may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils, suggesting its involvement in immune responses.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ephrin-A4 at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse EPHA7. The ED50 for this effect is 1.214μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
O08542 (L26-G176)
-
Molecular Construction
-
N-term
-
EFNA4 (L26-G176)
Accession # O08542 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
EFNA4; Ephrin-A4; Prev. EPLG4; Ligand Of Eph-Related Kinase 4; LERK4; EFL4; EPH-Related Receptor Tyrosine Kinase Ligand 4; Ephrin A4; LERK-4
-
AA Sequence
LRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESG
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)