EXOSC2 Protein, Human (His, StrepⅡ)
EXOSC2 is a non-catalytic RNA exosome complex component that plays an important role in 3'->5' exoribonuclease activity and affects a variety of cellular RNA processing and degradation processes. In the nucleus, it helps stabilize the maturation of RNA species and eliminates processing by-products, non-coding transcripts and defective mRNAs. EXOSC2 Protein, Human (His, Strep) is the recombinant human-derived EXOSC2 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
EXOSC2 is a non-catalytic RNA exosome complex component that plays an important role in 3'->5' exoribonuclease activity and affects a variety of cellular RNA processing and degradation processes. In the nucleus, it helps stabilize the maturation of RNA species and eliminates processing by-products, non-coding transcripts and defective mRNAs. EXOSC2 Protein, Human (His, Strep) is the recombinant human-derived EXOSC2 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
EXOSC2, a non-catalytic component of the RNA exosome complex, plays a crucial role in 3'->5' exoribonuclease activity, contributing to diverse cellular RNA processing and degradation events. Within the nucleus, the RNA exosome complex facilitates the proper maturation of stable RNA species, including rRNA, snRNA, and snoRNA, while eliminating RNA processing by-products, non-coding transcripts such as antisense RNA species, promoter-upstream transcripts (PROMPTs), and mRNAs with processing defects. This process limits their export to the cytoplasm. The RNA exosome is implicated in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM), directing AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, EXOSC2 contributes to general mRNA turnover and selectively degrades inherently unstable mRNAs with AU-rich elements (AREs) within their 3' untranslated regions, preventing the translation of aberrant mRNAs in RNA surveillance pathways. Additionally, it appears to be involved in the degradation of histone mRNA. As a component of the catalytically inactive RNA exosome core (Exo-9), EXOSC2 plays a crucial role in binding and presenting RNA for ribonucleolysis, serving as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC2, as a peripheral part of the Exo-9 complex, stabilizes the hexameric ring of RNase PH domain-containing subunits, forming contacts with EXOSC4 and EXOSC7. This multifaceted interaction underscores the versatile role of EXOSC2 in RNA-related processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-StrepⅡ;N-6*His
-
Accession
Q13868 (M1-G293)
-
Gene ID23404
-
Molecular Construction
-
N-term
-
StrepⅡ-6*His
-
EXOSC2 (M1-G293)
Accession # Q13868 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EXOSC2; P7; Exosome Component 2; Homolog Of Yeast RRP4 (Ribosomal RNA Processing 4), 3' 5' Exoribonuclease (RRP4); RRP4; Homolog Of Yeast RRP4 (Ribosomal RNA Processing 4), 3'-5'-Exoribonuclease; Ribosomal RNA-Processing Protein 4; CDNA FLJ52817, Highly S
-
AA Sequence
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)