FAM171A2 Protein, Human (96a.a, His)
Based on 1 Customer Validation
FAM171A2 Protein, Human (30-125a.a.) is the recombinant human-derived FAM171A2, expressed by E. coli , with C-6*His labeled tag. The total length of FAM171A2 Protein, Human (30-125a.a.) is 96 a.a.,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FAM171A2 Protein, Human (30-125a.a.) is the recombinant human-derived FAM171A2, expressed by E. coli , with C-6*His labeled tag. The total length of FAM171A2 Protein, Human (30-125a.a.) is 96 a.a.,
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
A8MVW0 (K30-L125)
-
Gene ID284069
-
Molecular Construction
-
N-term
-
FAM171A2 (K30-L125)
Accession # A8MVW0 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FAM171A2; Family With Sequence Similarity 171, Member A2; Family With Sequence Similarity 171 Member A2; Alternative Protein FAM171A2; Protein FAM171A2; FAM171A2 Protein; MGC34829
-
AA Sequence
KSPPEPPSPQEILIKVQVYVSGELVPLARASVDVFGNRTLLAAGTTDSEGVATLPLSYRLGTWVLVTAARPGFLTNSVPWRVDKLPLYASVSLYLL
-
Predicted Molecular Mass
17.2 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
