1. Recombinant Proteins
  2. CD Antigens Fc Receptors Biotinylated Proteins
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FcγRIIB/CD32b
  6. Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P76799
Handling Instructions Technical Support

Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. ITIM phosphorylated by Fc γ RIIB/CD32b recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival. Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. ITIM phosphorylated by Fc γ RIIB/CD32b recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival. Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. It plays a key role in a variety of effects and regulatory functions, including phagocytosis of immune complexes and regulation of B-cell antibody production. Upon binding to this receptor, down-regulation of the previous state of cell activation is triggered by an antigen receptor on B cells (BCR), T cells (TCR), or another Fc receptor. The IIB1 subtype does not mediate endocytosis or phagocytosis, while the IIB2 subtype does not induce phagocytosis. Fc γ RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN. Fc γ RIIB/CD32b -phosphorylated ITIM recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival[1][2][3].

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-His

Accession

Q8SPW3 (A45-G220)

Gene ID
Molecular Construction
N-term
CD32b (A45-G220)
Accession # Q8SPW3
Avi-His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b; IgG Fc Receptor II-b; CDw32; Fc-Gamma RII-b; Fc-Gamma-RIIb; FcRII-b; CD32; FCGR2B; FCG2; IGFR2
AA Sequence

AAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETILLRCHSWKDKPLIKVTFFQNGISKKFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSMG

Predicted Molecular Mass
23.5 kDa
Molecular Weight

Approximately 34 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P76799
Quantity:
MCE Japan Authorized Agent: