Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. ITIM phosphorylated by Fc γ RIIB/CD32b recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival. Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. ITIM phosphorylated by Fc γ RIIB/CD32b recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival. Fc gamma RIIB/CD32b Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
Fc γ RIIB/CD32b proteins exhibit low affinity as complexes or receptors that aggregate the immunoglobulin γFc region. It plays a key role in a variety of effects and regulatory functions, including phagocytosis of immune complexes and regulation of B-cell antibody production. Upon binding to this receptor, down-regulation of the previous state of cell activation is triggered by an antigen receptor on B cells (BCR), T cells (TCR), or another Fc receptor. The IIB1 subtype does not mediate endocytosis or phagocytosis, while the IIB2 subtype does not induce phagocytosis. Fc γ RIIB/CD32b interacts with INPP5D/SHIP1, FGR, and LYN. Fc γ RIIB/CD32b -phosphorylated ITIM recruits inositol phosphatases SHIP1 and SHIP2, inhibits Ras activation, down-regulates MAPK activity, reduces PLC-γ function, and results in PKC activation. Inhibition of MAP kinase pathway and anti-apoptotic kinase Akt inhibit cell proliferation and survival[1][2][3].
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q8SPW3 (A45-G220)
-
Molecular Construction
-
N-term
-
CD32b (A45-G220)
Accession # Q8SPW3 -
Avi-His
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
FCGR2B; Fc-Gamma-RIIb; Prev. FCG2; FcGRIIB; Prev. FCGR2; FcRII-B; CD32; IGFR2; CD32B; CDw32; Fc Fragment Of IgG, Low Affinity IIb, Receptor For (CD32); Fc Fragment Of IgG, Low Affinity II, Receptor For (CD32); Low Affinity Immunoglobulin Gamma Fc Region R
-
AA Sequence
AAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETILLRCHSWKDKPLIKVTFFQNGISKKFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSMG
-
Predicted Molecular Mass
23.5 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
