1. Recombinant Proteins
  2. Fc Receptors
  3. Fc-gamma Receptor
  4. Fc gamma RIII/CD16
  5. Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His)

Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His)

Cat. No.: HY-P70708A
Handling Instructions Technical Support

Fc gamma RIII/CD16 Protein, a low-affinity receptor for IgG1, IgG2a, and IgG2b, is crucial for mediating neutrophil activation in response to IgG complexes. It functions redundantly with Fcgr4 and interacts with INPP5D/SHIP1, emphasizing its involvement in intracellular signaling pathways linked to immune responses. Fc gamma RIII/CD16's significance lies in facilitating cellular activation triggered by immunoglobulin binding. Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIII/CD16 Protein, a low-affinity receptor for IgG1, IgG2a, and IgG2b, is crucial for mediating neutrophil activation in response to IgG complexes. It functions redundantly with Fcgr4 and interacts with INPP5D/SHIP1, emphasizing its involvement in intracellular signaling pathways linked to immune responses. Fc gamma RIII/CD16's significance lies in facilitating cellular activation triggered by immunoglobulin binding. Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Fc gamma RIII/CD16 Protein serves as a low-affinity receptor for the Fc region of complexed immunoglobulins gamma, specifically binding to IgG1, IgG2a, and IgG2b. This receptor plays a crucial role in mediating neutrophil activation in response to IgG complexes, functioning redundantly with Fcgr4 in this process. The interaction with INPP5D/SHIP1 further highlights its involvement in intracellular signaling pathways associated with immune responses, underscoring its significance in facilitating cellular activation triggered by immunoglobulin binding.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P08508 (A31-T215)

Gene ID

14131

Molecular Construction
N-term
Fc gamma RIII/CD16 (A31-T215)
Accession # P08508
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Low affinity immunoglobulin gamma Fc region receptor III; Fcgr3; Fc gamma Receptor III; CD-antigen 16; CD16; FcRIII; IgG Fc receptor III
AA Sequence

ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

Molecular Weight

35-40 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P70708A
Quantity:
MCE Japan Authorized Agent: