Copy Link Print Information

Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His)

Fc gamma RIII/CD16 Protein, a low-affinity receptor for IgG1, IgG2a, and IgG2b, is crucial for mediating neutrophil activation in response to IgG complexes. It functions redundantly with Fcgr4 and interacts with INPP5D/SHIP1, emphasizing its involvement in intracellular signaling pathways linked to immune responses. Fc gamma RIII/CD16's significance lies in facilitating cellular activation triggered by immunoglobulin binding. Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Fc gamma RIII/CD16 Protein, a low-affinity receptor for IgG1, IgG2a, and IgG2b, is crucial for mediating neutrophil activation in response to IgG complexes. It functions redundantly with Fcgr4 and interacts with INPP5D/SHIP1, emphasizing its involvement in intracellular signaling pathways linked to immune responses. Fc gamma RIII/CD16's significance lies in facilitating cellular activation triggered by immunoglobulin binding. Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The Fc gamma RIII/CD16 Protein serves as a low-affinity receptor for the Fc region of complexed immunoglobulins gamma, specifically binding to IgG1, IgG2a, and IgG2b. This receptor plays a crucial role in mediating neutrophil activation in response to IgG complexes, functioning redundantly with Fcgr4 in this process. The interaction with INPP5D/SHIP1 further highlights its involvement in intracellular signaling pathways associated with immune responses, underscoring its significance in facilitating cellular activation triggered by immunoglobulin binding.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P08508 (A31-T215)

  • Gene ID
    14131
  • Molecular Construction
    • N-term
    • Fc gamma RIII/CD16 (A31-T215)
      Accession # P08508
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    Low affinity immunoglobulin gamma Fc region receptor III; IgG Fc receptor III; Fc-gamma RIII; FcRIII; CD16; Fcgr3

  • AA Sequence

    ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT

  • Molecular Weight

    Approximately 35-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) Product Image
    1/16
  • Fc gamma RIII/CD16 Protein, Mouse (HEK293, C-His) Product Image