Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His-Avi)

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His-Avi) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

Fc gamma RIII/CD16 Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG) and is optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating the process of antibody-dependent cellular cytotoxicity (ADCC) leading to the lysis of antibody-coated cells. It does not bind free monomeric IgG, thereby avoiding inappropriate effector cell activation in the absence of an antigenic trigger. This receptor mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation, limiting viral load and propagation. Fc gamma RIII/CD16 is crucial in generating memory-like adaptive NK cells capable of producing high amounts of IFNG, efficiently eliminating virus-infected cells via ADCC, and regulating NK cell survival and proliferation by preventing NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, initiating intracellular signaling cascades that drive NK cell activation. The ITAM-dependent signaling coupled with receptor phosphorylation by PKC mediates robust intracellular calcium flux, leading to the production of pro-inflammatory cytokines. Additionally, Fc gamma RIII/CD16 costimulates NK cells and triggers the lysis of target cells independently of IgG binding, mediating the antitumor activities of therapeutic antibodies. It also plays a role in enhanced ADCC in response to afucosylated IgGs. The protein forms a heterooligomeric complex with ITAM-containing signaling subunits, including homodimers of CD247 or FCER1G, or a heterodimer of CD247 and FCER1G, to constitute a functional receptor complex. Fc gamma RIII/CD16 interacts with the Fc region of antigen-complexed IgG, showing a preference for IgG1 and IgG3 isotypes. It further interacts with CD2, contributing to NK cell activation and cytotoxicity, and with S100A4, inhibiting PKC-dependent phosphorylation of FCGR3A.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Fc gamma RIII/CD16 (G17-Q208)
      Accession # NP_001258584.1
    • Avi-His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FCGR3A; CD16; Prev. FCGR3; Fc Fragment Of IgG, Low Affinity IIIa, Receptor For (CD16); Prev. FCG3; Fc Of IgG Low Affinity IIIa Receptor Isoform 2; FcgammaRIIIa; Fc Of IgG Low Affinity IIIa Receptor Isoform 1; FcGRIIIA; Immunoglobulin G Fc Receptor III; CD

  • AA Sequence

    GMRAEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ

  • Predicted Molecular Mass

    25.3 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00