Fc gamma RIIIB/CD16b Protein, Human (NA2, HEK293, Twin Strep)

Fc gamma RIIIB/CD16b Protein, a low-affinity receptor for IgG, binds complexed or monomeric IgG. Unlike Fc gamma RIIIA, it cannot mediate antibody-dependent cytotoxicity or phagocytosis. Instead, Fc gamma RIIIB may act as a trap for immune complexes, circulating without activating neutrophils. Existing as a monomer, it interacts with INPP5D/SHIP1, implying its role in intracellular signaling pathways linked to immune responses. Fc gamma RIIIB/CD16b Protein, Human (NA2, HEK293, Twin Strep) is the recombinant human-derived Fc gamma RIIIB/CD16b protein, expressed by HEK293, with C-Twin-Strep labeled tag.

The Fc gamma RIIIB/CD16b Protein acts as a receptor for the Fc region of immunoglobulins gamma, exhibiting low affinity and binding to both complexed or aggregated IgG as well as monomeric IgG. In contrast to Fc gamma RIIIA, Fc gamma RIIIB lacks the ability to mediate antibody-dependent cytotoxicity and phagocytosis. Instead, it may function as a trap for immune complexes circulating in the periphery, without activating neutrophils. The protein exists as a monomer and interacts with INPP5D/SHIP1, suggesting its involvement in intracellular signaling pathways associated with immune responses.

Human

HEK293

C-Twin-Strep

O75015 (G17-S200)

2215

Full Length of Mature Protein

GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.