FCRL2 Protein, Human (Biotinylated, HEK293, His)
The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived FCRL2 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived FCRL2 protein, expressed by HEK293, with C-His labeled tag.
Background
The FCRL2 protein appears to have a regulatory role in both normal and neoplastic B cell development, suggesting its involvement in the intricate processes governing B cell maturation and function. Particularly, the tyrosine-phosphorylated isoform 2 of FCRL2 is known to interact with PTPN6, indicating a potential signaling pathway and emphasizing the protein's role in cellular regulation. The specific mechanisms through which FCRL2 influences B cell development and its interaction with PTPN6 remain areas of interest, underscoring the protein's importance in immune system processes and its potential relevance in the context of B cell-related disorders.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His;C-His
-
Accession
Q96LA5-1 (L20-V401)
-
Gene ID79368
-
Molecular Construction
-
N-term
-
FCRL2 (L20-V401)
Accession # /Q96LA5-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
FCRL2; SH2 Domain Containing Phosphatase Anchor Protein 1; Prev. SPAP1; Immunoglobulin Superfamily Fc Receptor, Gp42; FCRH2; Fc Receptor-Like 2; IRTA4; FcR-Like Protein 2; CD307b; CD307b Antigen; Immunoglobulin Receptor Translocation-Associated Protein 4;
-
AA Sequence
LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGV
-
Predicted Molecular Mass
42.7 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
