FCRL2 Protein, Human (Biotinylated, HEK293, His)

The FCRL2 protein regulates normal and neoplastic B cell development and has been shown to be involved in complex processes that control B cell maturation. Its tyrosine-phosphorylated isoform 2 interacts with PTPN6, suggesting the existence of a signaling pathway and emphasizing the role of this protein in cellular regulation. FCRL2 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived FCRL2 protein, expressed by HEK293, with C-His labeled tag.

The FCRL2 protein appears to have a regulatory role in both normal and neoplastic B cell development, suggesting its involvement in the intricate processes governing B cell maturation and function. Particularly, the tyrosine-phosphorylated isoform 2 of FCRL2 is known to interact with PTPN6, indicating a potential signaling pathway and emphasizing the protein's role in cellular regulation. The specific mechanisms through which FCRL2 influences B cell development and its interaction with PTPN6 remain areas of interest, underscoring the protein's importance in immune system processes and its potential relevance in the context of B cell-related disorders.

Human

HEK293

C-8*His

Q96LA5-1 (L20-V401)

79368

Extracellular Domain

Biotin

LTLVAPSSVFEGDSIVLKCQGEQNWKIQKMAYHKDNKELSVFKKFSDFLIQSAVLSDSGNYFCSTKGQLFLWDKTSNIVKIKVQELFQRPVLTASSFQPIEGGPVSLKCETRLSPQRLDVQLQFCFFRENQVLGSGWSSSPELQISAVWSEDTGSYWCKAETVTHRIRKQSLQSQIHVQRIPISNVSLEIRAPGGQVTEGQKLILLCSVAGGTGNVTFSWYREATGTSMGKKTQRSLSAELEIPAVKESDAGKYYCRADNGHVPIQSKVVNIPVRIPVSRPVLTLRSPGAQAAVGDLLELHCEALRGSPPILYQFYHEDVTLGNSSAPSGGGASFNLSLTAEHSGNYSCEANNGLGAQCSEAVPVSISGPDGYRRDLMTAGV

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.