1. Recombinant Proteins
  2. Others
  3. FGF-9 Protein, Canine (HEK293, mFc)

FGF-9 Protein, Canine (HEK293, mFc) is the recombinant canine-derived FGF-9 protein, expressed by HEK293, with N-mFc tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-9 Protein, Canine (HEK293, mFc) is the recombinant canine-derived FGF-9 protein, expressed by HEK293, with N-mFc tag.

Background

The FGF-9 Protein, belonging to the fibroblast growth factor (FGF) family, exhibits broad mitogenic and cell survival activities, participating in various biological processes such as embryonic development, cell growth, morphogenesis, tissue repair, and tumor growth and invasion. Originally identified as a secreted factor with growth-stimulating effects on cultured glial cells, this protein is predominantly produced by neurons in the nervous system, suggesting its importance in glial cell development. The expression of the mouse homolog of FGF-9 is contingent on Sonic hedgehog (Shh) signaling, and its absence in mice led to a male-to-female sex reversal phenotype, indicating a role in testicular embryogenesis. Noteworthy is the biased expression of FGF-9, with elevated levels detected in the kidney (RPKM 6.4), adrenal (RPKM 2.1), and 10 other tissues, underscoring its potential significance in various physiological contexts across multiple organs.

Species

Canine

Source

HEK293

Tag

N-mFc

Accession

NP_002001.1 (L4-S208)

Gene ID

2254

Protein Length

Full Length of Mature Protein

Synonyms
Fibroblast growth factor 9; FGF-9; GAF; HBGF-9
AA Sequence

LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Predicted Molecular Mass
49.8 kDa
Molecular Weight

Approximately 50 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 75%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FGF-9 Protein, Canine (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGF-9 Protein, Canine (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-9 Protein, Canine (HEK293, mFc)
Cat. No.:
HY-P703768
Quantity:
MCE Japan Authorized Agent: