FGF basic/bFGF Protein, Sheep (P. pastoris, His)
- Species: Sheep
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Technical Parameters
-
Species Sheep
-
Source P. pastoris
-
Tag C-6*His
-
Accession
P20003 (P10-S155)
-
Gene ID443306
-
Molecular Construction
-
N-term
-
FGF basic/bFGF (P10-S155)
Accession # P20003 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF2; BFGF; Prev. FGFB; Basic Fibroblast Growth Factor; Fibroblast Growth Factor 2 (Basic); Fibroblast Growth Factor; Heparin-Binding Growth Factor 2; Prostatropin; HBGF-2; FGF2A; FGF-2; FGF; Fibroblast Growth Factor 2; Basic Fibroblast Growth Factor BFGF
-
AA Sequence
PALPEDGGSSAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)