Copy Link Print Information

FGF basic/bFGF Protein, Human (P. pastoris, N-His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (P. pastoris, N-His)
  • FGF basic/bFGF Protein, Human (P. pastoris, N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF basic, or bFGF (fibroblast growth factor basic), initiates at an alternative CUG codon, marking a distinctive feature in translational initiation. This alternative start codon plays a pivotal role in regulating the expression and functional properties of FGF basic. FGF basic/bFGF Protein, Human (P. pastoris, N-His) is the recombinant human-derived FGF basic/bFGF protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Initiation of FGF basic, also known as bFGF (fibroblast growth factor basic), occurs at an alternative CUG codon. This alternative start codon represents a distinctive feature in the translational initiation of the protein, contributing to the unique regulatory mechanisms governing the expression and functional properties of FGF basic.

Verified Bioactivity

Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 0.9354 ng/mL, corresponding to a specific activity is 1.07×10^6 units/mg.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 0.9354 ng/mL, corresponding to a specific activity is 1.07×106 units/mg.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession

    P09038-4 (P143-S288)

  • Gene ID
    2247  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • bFGF (P143-S288)
      Accession # P09038-4
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    FGF2; BFGF; Prev. FGFB; Basic Fibroblast Growth Factor; Fibroblast Growth Factor 2 (Basic); Fibroblast Growth Factor; Heparin-Binding Growth Factor 2; Prostatropin; HBGF-2; FGF2A; FGF-2; FGF; Fibroblast Growth Factor 2; Basic Fibroblast Growth Factor BFGF

  • AA Sequence

    PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Predicted Molecular Mass

    17.9 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH/3T3 mouse fibroblast cells. The ED50 for this effect is 0.9354 ng/mL, corresponding to a specific activity is 1.07×106 units/mg.

  • FGF basic/bFGF Protein, Human (P. pastoris, N-His) Product Image
    1/16
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (P. pastoris, N-His)
  • FGF basic/bFGF Protein, Human (P. pastoris, N-His) Product Image