FGL1 Protein, Human (HEK293, Fc)

FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (HEK293, Fc) is the recombinant human-derived FGL1 protein, expressed by HEK293, with C-hFc labeled tag.

FGL1 protein functions as an immune suppressive molecule, exerting inhibitory effects on antigen-specific T-cell activation by serving as a major ligand for LAG3. It plays a pivotal role in mediating LAG3's T-cell inhibitory function independently of MHC class II (MHC-II) binding. Beyond its immune-regulatory role, FGL1 is secreted by hepatocytes, contributing to their growth. Existing as a homodimer, FGL1 interacts with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This molecular interaction, detailed in studies, underscores the significance of FGL1 in modulating immune responses and hepatocyte growth, highlighting its potential as a key player in the regulation of T-cell activation and hepatic functions.

Measured by its binding ability in a functional ELISA. Immobilized Human LAG-3, Mouse IgG2a Fc Tag at 10 μg/mL (100 μL/well) can bind Human FGL1, Fc Tag with the EC₅₀ of 0.06 μg/mL.

Human

HEK293

N-hFc

Q08830 (L23-I312)

2267

Full Length of Mature Peptide

LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 150 mM NaCl, pH7.5 with 10% trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.