FGL2 Protein, Human (HEK293, His)
FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His) is the recombinant human-derived FGL2 protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His) is the recombinant human-derived FGL2 protein, expressed by HEK293, with N-His labeled tag.
Background
The FGL2 protein appears to play a role in physiologic lymphocyte functions at mucosal sites, suggesting its involvement in immune responses specific to mucosal tissues. Its potential contribution to lymphocyte functions implies a role in the regulation of immune activities at these specialized sites. Structurally, FGL2 forms homotetramers that are disulfide-linked, highlighting its quaternary structure. Further exploration into the specific mechanisms by which FGL2 influences physiologic lymphocyte functions at mucosal sites and the functional consequences of its homotetrameric organization could provide valuable insights into its role in mucosal immunity and immune system regulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q14314 (N24-P439)
-
Gene ID10875
-
Molecular Construction
-
N-term
-
His
-
FGL2 (N24-P439)
Accession # Q14314 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGL2; Fibrinogen-Like Protein 2; Fibrinogen Like 2; T49; Fibroleukin; Fibrinogen-Like 2; PT49
-
AA Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP
-
Predicted Molecular Mass
49.7 kDa
-
Molecular Weight
Approximately 64-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
