1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. FGL-2
  5. FGL2 Protein, Human (HEK293, His)

FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His) is the recombinant human-derived FGL2 protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGL2 protein is involved in immune responses specific to mucosal tissues, regulating physiologic lymphocyte functions. It forms disulfide-linked homotetramers, indicating its quaternary structure. Studying how FGL2 influences lymphocyte functions and its homotetrameric organization can provide insights into its role in mucosal immunity and immune system regulation. FGL2 Protein, Human (HEK293, His) is the recombinant human-derived FGL2 protein, expressed by HEK293, with N-His labeled tag.

Background

The FGL2 protein appears to play a role in physiologic lymphocyte functions at mucosal sites, suggesting its involvement in immune responses specific to mucosal tissues. Its potential contribution to lymphocyte functions implies a role in the regulation of immune activities at these specialized sites. Structurally, FGL2 forms homotetramers that are disulfide-linked, highlighting its quaternary structure. Further exploration into the specific mechanisms by which FGL2 influences physiologic lymphocyte functions at mucosal sites and the functional consequences of its homotetrameric organization could provide valuable insights into its role in mucosal immunity and immune system regulation.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q14314 (N24-P439)

Gene ID

10875

Molecular Construction
N-term
His
FGL2 (N24-P439)
Accession # Q14314
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Fibroleukin; pT49; FGL2; fibrinogen-like 2;
AA Sequence

NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYRLHVGNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPKHFKP

Predicted Molecular Mass
49.7 kDa.
Molecular Weight

Approximately 64-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FGL2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FGL2 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGL2 Protein, Human (HEK293, His)
Cat. No.:
HY-P704614
Quantity:
MCE Japan Authorized Agent: