1. Recombinant Proteins
  2. Others
  3. Fibronectin Protein, Human (91a.a, HEK293, hFc)

Fibronectin Protein, Human (91a.a, HEK293, hFc)

Cat. No.: HY-P703742
Handling Instructions Technical Support

Fibronectin (1266-1356) Protein, Human (HEK293, hFc) is the recombinant human-derived Fibronectin protein, expressed by HEK293, with C-hFc tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fibronectin (1266-1356) Protein, Human (HEK293, hFc) is the recombinant human-derived Fibronectin protein, expressed by HEK293, with C-hFc tag.

Background

Fibronectin, a versatile glycoprotein, plays a crucial role in cellular interactions by binding to various compounds such as collagen, fibrin, heparin, DNA, and actin. Its involvement in cell adhesion, motility, opsonization, wound healing, and maintenance of cell shape underscores its significance in fundamental cellular processes. Fibronectin also contributes to osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization, and regulates the deposition of type I collagen by osteoblasts. Acting as a ligand for the LILRB4 receptor, Fibronectin inhibits FCGR1A/CD64-mediated monocyte activation. Moreover, Fibronectin's ability to induce fibril formation, as observed in the fibronectin polymer named superfibronectin, imparts enhanced adhesive properties. Notably, both anastellin and superfibronectin exhibit inhibitory effects on tumor growth, angiogenesis, and metastasis, with anastellin activating p38 MAPK and inhibiting lysophospholipid signaling. The multifaceted functions of Fibronectin underscore its pivotal role in cellular dynamics and its potential as a target for therapeutic interventions in various pathological conditions.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

P02751-13 (E1266-T1356)

Gene ID

2335

Protein Length

Partial

Synonyms
Fibronectin; FN1; Cold-insoluble globulin (CIG); FN
AA Sequence

EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT

Predicted Molecular Mass
36.5 kDa
Molecular Weight

Approximately 47-57 kDa,based on Bis-Tris PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fibronectin Protein, Human (91a.a, HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fibronectin Protein, Human (91a.a, HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fibronectin Protein, Human (91a.a, HEK293, hFc)
Cat. No.:
HY-P703742
Quantity:
MCE Japan Authorized Agent: