Fibronectin Protein, Human (91a.a, HEK293, hFc)
Based on 1 Customer Validation
Fibronectin (1266-1356) Protein, Human (HEK293, hFc) is the recombinant human-derived Fibronectin protein, expressed by HEK293, with C-hFc tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Fibronectin (1266-1356) Protein, Human (HEK293, hFc) is the recombinant human-derived Fibronectin protein, expressed by HEK293, with C-hFc tag.
Background
Fibronectin, a versatile glycoprotein, plays a crucial role in cellular interactions by binding to various compounds such as collagen, fibrin, heparin, DNA, and actin. Its involvement in cell adhesion, motility, opsonization, wound healing, and maintenance of cell shape underscores its significance in fundamental cellular processes. Fibronectin also contributes to osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization, and regulates the deposition of type I collagen by osteoblasts. Acting as a ligand for the LILRB4 receptor, Fibronectin inhibits FCGR1A/CD64-mediated monocyte activation. Moreover, Fibronectin's ability to induce fibril formation, as observed in the fibronectin polymer named superfibronectin, imparts enhanced adhesive properties. Notably, both anastellin and superfibronectin exhibit inhibitory effects on tumor growth, angiogenesis, and metastasis, with anastellin activating p38 MAPK and inhibiting lysophospholipid signaling. The multifaceted functions of Fibronectin underscore its pivotal role in cellular dynamics and its potential as a target for therapeutic interventions in various pathological conditions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P02751-13 (E1266-T1356)
-
Gene ID2335
-
Protein Length
Partial
-
Synonyms
FN1; Epididymis Secretory Sperm Binding Protein; Fibronectin 1; Fibronectin Splice Variant A; CIG; Fibronectin Splice Variant B; Cold-Insoluble Globulin; Fibronectin Splice Variant C; Lnc-ABCA12-8; Fibronectin Splice Variant D; Fibronectin; Fibronectin Sp
-
AA Sequence
EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT
-
Predicted Molecular Mass
36.5 kDa
-
Molecular Weight
Approximately 47-57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)