Fibronectin Protein, Human (91a.a, HEK293, hFc)

Customer Review

Based on 1 Customer Validation

Fibronectin (1266-1356) Protein, Human (HEK293, hFc) is the recombinant human-derived Fibronectin protein, expressed by HEK293, with C-hFc tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Fibronectin (1266-1356) Protein, Human (HEK293, hFc) is the recombinant human-derived Fibronectin protein, expressed by HEK293, with C-hFc tag.

Background

Fibronectin, a versatile glycoprotein, plays a crucial role in cellular interactions by binding to various compounds such as collagen, fibrin, heparin, DNA, and actin. Its involvement in cell adhesion, motility, opsonization, wound healing, and maintenance of cell shape underscores its significance in fundamental cellular processes. Fibronectin also contributes to osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization, and regulates the deposition of type I collagen by osteoblasts. Acting as a ligand for the LILRB4 receptor, Fibronectin inhibits FCGR1A/CD64-mediated monocyte activation. Moreover, Fibronectin's ability to induce fibril formation, as observed in the fibronectin polymer named superfibronectin, imparts enhanced adhesive properties. Notably, both anastellin and superfibronectin exhibit inhibitory effects on tumor growth, angiogenesis, and metastasis, with anastellin activating p38 MAPK and inhibiting lysophospholipid signaling. The multifaceted functions of Fibronectin underscore its pivotal role in cellular dynamics and its potential as a target for therapeutic interventions in various pathological conditions.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    FN1; Epididymis Secretory Sperm Binding Protein; Fibronectin 1; Fibronectin Splice Variant A; CIG; Fibronectin Splice Variant B; Cold-Insoluble Globulin; Fibronectin Splice Variant C; Lnc-ABCA12-8; Fibronectin Splice Variant D; Fibronectin; Fibronectin Sp

  • AA Sequence

    EVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT

  • Predicted Molecular Mass

    36.5 kDa

  • Molecular Weight

    Approximately 47-57 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00