FITC-Labeled PSMA Protein, Human (HEK293, His)
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q04609-1 (K44-A750)
-
Gene ID2346
-
Molecular Construction
-
N-term
-
His
-
PSMA (K44-A750)
Accession # Q04609-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FOLH1; Folylpoly-Gamma-Glutamate Carboxypeptidase; Prev. FOLH; Membrane Glutamate Carboxypeptidase; NAALAD1; Glutamate Carboxylase II; GCPII; NAALADase I; PSMA; NAALAdase; PSM; FGCP; Glutamate Carboxypeptidase II; MGCP; Glutamate Carboxypeptidase 2; Folat
-
AA Sequence
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
-
Predicted Molecular Mass
81.4 kDa
-
Molecular Weight
Approximately 85-115 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
