FITC-Labeled Siglec-3/CD33 Protein, Human (HEK293, His)
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
AAH28152.1 (D18-H259)
-
Gene ID945
-
Molecular Construction
-
N-term
-
CD33 (D18-H259)
Accession # AAH28152.1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD33; Myeloid Cell Surface Antigen CD33; CD33 Molecule; FLJ00391; SIGLEC3; Gp67; CD33 Antigen (Gp67); CDNA FLJ50122, Highly Similar To Myeloid Cell Surface Antigen CD33; CD33rSiglec; Sialic Acid Binding Ig-Like Lectin 3; SIGLEC-3; CD33 Molecule Transcript; P67; CD33 Antigen; Sialic Acid-Binding Ig-Like Lectin 3; Siglec-3
-
AA Sequence
DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH
-
Predicted Molecular Mass
27.6 kDa
-
Molecular Weight
Approximately 40-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 1 year from date of receipt, protect from light. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
