1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. FKBP12 Protein, Human (His, solution)

FKBP12 protein maintains TGFBR1 in an inactive state, inhibits activin signaling by recruiting SMAD7, and modulates RYR1 calcium channel activity. As a PPIase, it speeds up protein folding. FKBP12's multifunctionality underscores its regulatory role in cellular processes, emphasizing its importance in signaling and protein folding. FKBP12 Protein, Human (His) is the recombinant human-derived FKBP12 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FKBP12 protein maintains TGFBR1 in an inactive state, inhibits activin signaling by recruiting SMAD7, and modulates RYR1 calcium channel activity. As a PPIase, it speeds up protein folding. FKBP12's multifunctionality underscores its regulatory role in cellular processes, emphasizing its importance in signaling and protein folding. FKBP12 Protein, Human (His) is the recombinant human-derived FKBP12 protein, expressed by E. coli , with C-His labeled tag.

Background

FKBP12 protein plays a crucial role in maintaining the inactive conformation of TGFBR1, the serine/threonine kinase receptor for TGF-beta, effectively preventing receptor activation in the absence of ligand. Additionally, FKBP12 recruits SMAD7 to ACVR1B, inhibiting the association of SMAD2 and SMAD3 with the activin receptor complex and thereby blocking activin signaling. This multifunctional protein may also modulate the activity of the RYR1 calcium channel. As a peptidyl-prolyl cis-trans isomerase (PPIase), FKBP12 accelerates the folding of proteins by catalyzing the isomerization of proline imidic peptide bonds in oligopeptides. The diverse functions of FKBP12 highlight its regulatory role in various cellular processes, emphasizing its significance in intracellular signaling and protein folding.

Biological Activity

Measured by its ability to convert the substrate, Suc-AAPF-pNA (HY-P2573), from Cis to Trans formation. The specific activity is 2319.245 pmol/min/μg.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P62942/NP_463460.1 (M1-E108)

Gene ID
Molecular Construction
N-term
FKBP12 (M1-E108)
Accession # P62942/NP_463460.1
6*His
C-term
Protein Length

Full Length

Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP1A; FKBP-12; Calstabin-1; FKBP-1A; FKBP1
AA Sequence

MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Predicted Molecular Mass
12.9 kDa
Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FKBP12 Protein, Human (His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FKBP12 Protein, Human (His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FKBP12 Protein, Human (His, solution)
Cat. No.:
HY-P76345
Quantity:
MCE Japan Authorized Agent: