FKBP12 Protein, Human (His, solution)
Based on 1 Customer Validation
FKBP12 protein maintains TGFBR1 in an inactive state, inhibits activin signaling by recruiting SMAD7, and modulates RYR1 calcium channel activity. As a PPIase, it speeds up protein folding. FKBP12's multifunctionality underscores its regulatory role in cellular processes, emphasizing its importance in signaling and protein folding. FKBP12 Protein, Human (His) is the recombinant human-derived FKBP12 protein, expressed by E. coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FKBP12 protein maintains TGFBR1 in an inactive state, inhibits activin signaling by recruiting SMAD7, and modulates RYR1 calcium channel activity. As a PPIase, it speeds up protein folding. FKBP12's multifunctionality underscores its regulatory role in cellular processes, emphasizing its importance in signaling and protein folding. FKBP12 Protein, Human (His) is the recombinant human-derived FKBP12 protein, expressed by E. coli , with C-His labeled tag.
FKBP12 protein plays a crucial role in maintaining the inactive conformation of TGFBR1, the serine/threonine kinase receptor for TGF-beta, effectively preventing receptor activation in the absence of ligand. Additionally, FKBP12 recruits SMAD7 to ACVR1B, inhibiting the association of SMAD2 and SMAD3 with the activin receptor complex and thereby blocking activin signaling. This multifunctional protein may also modulate the activity of the RYR1 calcium channel. As a peptidyl-prolyl cis-trans isomerase (PPIase), FKBP12 accelerates the folding of proteins by catalyzing the isomerization of proline imidic peptide bonds in oligopeptides. The diverse functions of FKBP12 highlight its regulatory role in various cellular processes, emphasizing its significance in intracellular signaling and protein folding.
Measured by its ability to convert the substrate, Suc-AAPF-pNA (HY-P2573), from Cis to Trans formation. The specific activity is 2319.245 pmol/min/μg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P62942/NP_463460.1 (M1-E108)
-
Molecular Construction
-
N-term
-
FKBP12 (M1-E108)
Accession # P62942/NP_463460.1 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
FKBP1A; Calstabin-1; Prev. FKBP1; FKBP12C; FKBP-12; FKBP-1A; FKBP12; FK506-Binding Protein, T-Cell, 12-KD; PPIASE; FK506-Binding Protein 1A (12kD); PKC12; Protein Kinase C Inhibitor 2; Peptidyl-Prolyl Cis-Trans Isomerase FKBP1A; FK506 Binding Protein 1A;
-
AA Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
-
Predicted Molecular Mass
12.9 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
