FOLR1 Protein, Mouse (HEK293, Fc)
FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FOLR1 Protein, binding to folate and reduced folic acid derivatives, facilitates their delivery into cells. It maintains high affinity under neutral pH but undergoes a conformational change upon endocytosis, reducing affinity and releasing folates in slightly acidic pH. Crucial for embryonic development, cell proliferation, and renal folate reabsorption. FOLR1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived FOLR1 protein, expressed by HEK293, with C-hFc labeled tag.
Background
The FOLR1 protein binds to folate and reduced folic acid derivatives, facilitating the delivery of 5-methyltetrahydrofolate and folate analogs into cells. It exhibits a high affinity for folate and folic acid analogs under neutral pH conditions. Upon endocytosis and exposure to slightly acidic pH, a conformational change occurs, leading to a significant reduction in its affinity for folates and subsequent release. This protein is essential for normal embryonic development, cell proliferation, and renal folate reabsorption.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P35846 (T25-S232)
-
Gene ID14275
-
Molecular Construction
-
N-term
-
FOLR1 (T25-S232)
Accession # P35846 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FOLR1; KB Cells FBP; Prev. FOLR; FBP; Ovarian Tumor-Associated Antigen MOv18; Folate Binding Protein; Adult Folate-Binding Protein; FRalpha; Folate Receptor 1 (Adult); NCFTD; Folate Receptor, Adult; FRα; Folate Receptor 1; FRA; Folate Receptor Alpha; FR-A
-
AA Sequence
TRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMS
-
Predicted Molecular Mass
50.7 kDa
-
Molecular Weight
Approximately 57-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)