FOLR2 Protein, Cynomolgus (HEK293, His)
The FOLR2 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that play a key role in the uptake and transport of folate (vitamin B9) into cells. FOLR2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FOLR2 protein is a member of the folate receptor family. Folate receptors are cell surface proteins that play a key role in the uptake and transport of folate (vitamin B9) into cells. FOLR2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived FOLR2 protein, expressed by HEK293 , with C-His labeled tag.
Background
FOLR2 Protein is a member of the folate receptor family. Folate receptors are cell surface proteins that play a critical role in the uptake and transport of folate (vitamin B9) into cells. FOLR2 is expressed in various tissues, including the placenta, kidney, and lung, although its expression levels are generally lower compared to other folate receptors. Like other members of the folate receptor family, FOLR2 is involved in folate metabolism and may participate in cellular processes such as folate uptake and transport. However, compared to FOLR1, less is known about the specific functions and roles of FOLR2. Further research is needed to fully understand the precise functions and significance of FOLR2 in cellular processes and its potential implications in health and disease.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-6*His
-
Accession
A0A2K5U027 (Q9-H187)
-
Molecular Construction
-
N-term
-
FOLR2 (Q9-H187)
Accession # A0A2K5U027 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
FOLR2; FOLR2 Protein; Folate Receptor Beta; BETA-HFR; Folate Receptor, Fetal/Placental; FBP/PL-1; Placental Folate-Binding Protein; FR-BETA; Folate Receptor 2 (Fetal); FR-Beta; FBP; FRbeta; Folate-Binding Protein, Fetal/Placental; FR-P3; Folate Receptor A
-
AA Sequence
QCSPWKKNACCTANTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIRQVNQSWRKERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCLTFESYFPTPVALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAVMH
-
Predicted Molecular Mass
25.5 kDa
-
Molecular Weight
Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
