Frizzled-10/CD350 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The Frizzled-10/CD350 gene is a member of the Frizzled gene family, encoding a 7-transmembrane domain protein that acts as a receptor for the Wingless-type MMTV integration site family signaling protein. Most Frizzled receptors, including Frizzled-10/CD350, are involved in cell signaling, specifically the β-catenin classical pathway. Frizzled-10/CD350 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Frizzled-10/CD350 gene is a member of the Frizzled gene family, encoding a 7-transmembrane domain protein that acts as a receptor for the Wingless-type MMTV integration site family signaling protein. Most Frizzled receptors, including Frizzled-10/CD350, are involved in cell signaling, specifically the β-catenin classical pathway. Frizzled-10/CD350 Protein, Human (HEK293, His) is the recombinant human-derived Frizzled-10/CD350 protein, expressed by HEK293 , with C-His labeled tag.
Background
The Frizzled-10/CD350 gene belongs to the frizzled gene family, encoding 7-transmembrane domain proteins serving as receptors for the Wingless type MMTV integration site family of signaling proteins. Typically associated with the beta-catenin canonical signaling pathway, most frizzled receptors play crucial roles in cellular signaling. Notably, through array analysis, expression of this intronless gene demonstrates a significant up-regulation in two instances of primary colon cancer. This suggests a potential involvement of Frizzled-10/CD350 in the context of colon cancer, prompting further exploration of its specific contributions to signaling pathways and cancer progression.
Verified Bioactivity
Measured by its ability to bind biotinylated recombinant mouse Wnt-3a in a functional ELISA. The ED50 for this effect is 4.336 nM.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
NP_009128.1 (I21-G161)
-
Molecular Construction
-
N-term
-
CD350 (I21-G161)
Accession # NP_009128.1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FZD10; FzE7; Frizzled Class Receptor 10; Frizzled (Drosophila) Homolog 10; Frizzled-10; Frizzled Homolog 10; CD350; CD350 Antigen; Frizzled 10, Seven Transmembrane Spanning Receptor; FZ-10; Frizzled Homolog 10 (Drosophila); Fz-10; Frizzled Family Receptor
-
AA Sequence
ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRG
-
Molecular Weight
Approximately 22-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
