FUS Protein, Human (MBP-His)
FUS Protein, Human (MBP-His) is the recombinant human-derived FUS protein, expressed by E. coli, with N-His & N-MBP tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
FUS Protein, Human (MBP-His) is the recombinant human-derived FUS protein, expressed by E. coli, with N-His & N-MBP tag.
TLS/FUS is a DNA/RNA-binding protein involved in multiple cellular processes including transcription regulation, RNA splicing, RNA transport, DNA repair, and damage response. It specifically binds single-stranded RNA containing the 5'-AGGUAA-3' consensus sequence and interacts with nascent pre-mRNAs, serving as a molecular bridge between RNA polymerase II and U1 small nuclear ribonucleoprotein to couple transcription with splicing. The protein autoregulates its expression by binding its own pre-mRNA via nonsense-mediated decay. During DNA double-strand break repair, it promotes D-loop formation and homologous recombination. In neuronal cells (by similar), it plays essential roles in dendritic spine formation/stability, RNA transport, mRNA stability, and synaptic homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-MBP
-
Accession
P35637-1 (M1-Y526)
-
Gene ID2521
-
Molecular Construction
-
N-term
-
MBP
-
His
-
FUS (M1-Y526)
Accession # P35637-1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
FUS; Oncogene TLS; Prev. ALS6; AltFUS; TLS; Fusion (Involved In T(12; 16) In Malignant Liposarcoma); RNA-Binding Protein FUS; Fusion, Derived From T(12; 16) Malignant Liposarcoma; HNRNPP2; Fusion Gene In Myxoid Liposarcoma; FUS1; Amyotrophic Lateral Scleros
-
AA Sequence
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
-
Predicted Molecular Mass
97 kDa
-
Molecular Weight
Approximately 95 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
