FUT10 Protein, Human (HEK293, His)
The FUT10 protein plays a key role in glycosylation, primarily fucosylating the innermost GlcNAc residues in biantennary N-glycans. This activity generates a core α(1->3)-fucose epitope that serves as a recognition signal for targeted degradation of misfolded glycoproteins. FUT10 Protein, Human (HEK293, His) is the recombinant human-derived FUT10 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FUT10 protein plays a key role in glycosylation, primarily fucosylating the innermost GlcNAc residues in biantennary N-glycans. This activity generates a core α(1->3)-fucose epitope that serves as a recognition signal for targeted degradation of misfolded glycoproteins. FUT10 Protein, Human (HEK293, His) is the recombinant human-derived FUT10 protein, expressed by HEK293 , with N-His labeled tag.
Background
The FUT10 protein takes center stage in glycosylation processes by predominantly fucosylating the innermost N-acetyl glucosamine (GlcNAc) residue in biantennary N-glycan acceptors. This enzymatic activity is postulated to yield the core alpha(1->3)-fucose epitope within the chitobiose unit of biantennary N-glycans, serving as a recognition signal for the targeted degradation of aberrantly folded glycoproteins. Additionally, FUT10 plays a crucial role in the biosynthesis of Lewis X-carrying biantennary N-glycans, contributing to the regulation of neuron stem cell self-renewal during brain development. The enzyme catalyzes the transfer of the fucosyl moiety from GDP-beta-L-fucose to the innermost GlcNAc residue in biantennary N-glycan acceptors, while notably avoiding fucosylation of GlcNAc within the type 2 lactosamine unit.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q6P4F1-1 (L32-D479)
-
Molecular Construction
-
N-term
-
His
-
FUT10 (L32-D479)
Accession # Q6P4F1-1 -
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
POFUT3; Alpha (1,3) Fucosyltransferase; Prev. FUT10; Fuc-TX; Fucosyltransferase 10; FucT-X; GDP-Fucose Protein O-Fucosyltransferase 3; Fucosyltransferase 10 (Alpha (1,3) Fucosyltransferase); Galactoside 3-L-Fucosyltransferase 10; Alpha 1,3-Fucosyl Transfe
-
AA Sequence
LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLPLTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEVDSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEISNQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD
-
Predicted Molecular Mass
54.7 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
