1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. FUT10 Protein, Human (HEK293, His)

The FUT10 protein plays a key role in glycosylation, primarily fucosylating the innermost GlcNAc residues in biantennary N-glycans. This activity generates a core α(1->3)-fucose epitope that serves as a recognition signal for targeted degradation of misfolded glycoproteins. FUT10 Protein, Human (HEK293, His) is the recombinant human-derived FUT10 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The FUT10 protein plays a key role in glycosylation, primarily fucosylating the innermost GlcNAc residues in biantennary N-glycans. This activity generates a core α(1->3)-fucose epitope that serves as a recognition signal for targeted degradation of misfolded glycoproteins. FUT10 Protein, Human (HEK293, His) is the recombinant human-derived FUT10 protein, expressed by HEK293 , with N-His labeled tag.

Background

The FUT10 protein takes center stage in glycosylation processes by predominantly fucosylating the innermost N-acetyl glucosamine (GlcNAc) residue in biantennary N-glycan acceptors. This enzymatic activity is postulated to yield the core alpha(1->3)-fucose epitope within the chitobiose unit of biantennary N-glycans, serving as a recognition signal for the targeted degradation of aberrantly folded glycoproteins. Additionally, FUT10 plays a crucial role in the biosynthesis of Lewis X-carrying biantennary N-glycans, contributing to the regulation of neuron stem cell self-renewal during brain development. The enzyme catalyzes the transfer of the fucosyl moiety from GDP-beta-L-fucose to the innermost GlcNAc residue in biantennary N-glycan acceptors, while notably avoiding fucosylation of GlcNAc within the type 2 lactosamine unit.

Species

Human

Source

HEK293

Tag

N-His

Accession

Q6P4F1-1 (L32-D479)

Gene ID
Molecular Construction
N-term
His
FUT10 (L32-D479)
Accession # Q6P4F1-1
C-term
Protein Length

Lumenal Domain

Synonyms
Alpha-(1,3)-fucosyltransferase 10; Fucosyltransferase X; Fuc-TX; Fucosyltransferase 10
AA Sequence

LGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGTDFNIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLPLTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEVDSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEISNQRLLTALRERKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD

Predicted Molecular Mass
54.7 kDa
Molecular Weight

Approximately 55-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

FUT10 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FUT10 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FUT10 Protein, Human (HEK293, His)
Cat. No.:
HY-P76941
Quantity:
MCE Japan Authorized Agent: