Copy Link Print Information

Galactokinase/GALK1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Galactokinase (GALK1) protein facilitates the transfer of a phosphate group from ATP to alpha-D-galactose, playing a pivotal role in the initial and committed step of galactose catabolism. Through this enzymatic activity, GALK1 initiates the metabolic pathway responsible for breaking down galactose, contributing to its utilization within cellular processes. Galactokinase/GALK1 Protein, Human (His) is the recombinant human-derived Galactokinase/GALK1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Galactokinase/GALK1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Galactokinase (GALK1) protein facilitates the transfer of a phosphate group from ATP to alpha-D-galactose, playing a pivotal role in the initial and committed step of galactose catabolism. Through this enzymatic activity, GALK1 initiates the metabolic pathway responsible for breaking down galactose, contributing to its utilization within cellular processes. Galactokinase/GALK1 Protein, Human (His) is the recombinant human-derived Galactokinase/GALK1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

Galactokinase (GALK1) is an enzyme that plays a pivotal role in the catabolism of galactose by catalyzing the transfer of a phosphate group from ATP to alpha-D-galactose. This enzymatic activity represents the first committed step in the metabolic pathway of galactose, initiating its conversion into downstream metabolites. The phosphorylation of galactose by GALK1 is a crucial step in galactose utilization and allows for subsequent enzymatic reactions leading to the incorporation of galactose-derived metabolites into various cellular processes. Understanding the functions of GALK1 provides insights into the regulation of galactose metabolism and its importance in cellular energy production and the synthesis of glycoconjugates.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P51570 (M1-L392)

  • Gene ID
    2584  [NCBI]
  • Molecular Construction
    • N-term
    • GALK1 (M1-L392)
      Accession # P51570
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GALK1; Galactokinase; Prev. GALK; HEL-S-19; Galactose Kinase; GK1; Galactokinase 1; Epididymis Secretory Protein Li 19

  • AA Sequence

    MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL

  • Predicted Molecular Mass

    43.3 kDa

  • Molecular Weight

    Approximately 45 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 15% trehalose, 10% glycerol, 0.1% Tween 80, 1 mM TCEP, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Galactokinase/GALK1 Protein, Human (His) Product Image
    1/16
  • Galactokinase/GALK1 Protein, Human (His) Product Image