Galectin-7/LGALS7 Protein, Human (GST)
Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag.
Background
Galectin-7, also known as LGALS7, is a protein potentially involved in critical cell-cell and/or cell-matrix interactions essential for normal growth control. Functioning as a pro-apoptotic protein, Galectin-7 operates intracellularly upstream of JNK activation and cytochrome c release, suggesting its role in apoptotic pathways. It exists as a monomer, and its involvement in cellular interactions and apoptotic processes underscores its significance in regulating cell growth and survival. Understanding the functions of Galectin-7 provides valuable insights into the intricate molecular mechanisms governing normal cellular processes and apoptotic signaling.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P47929 (S2-F136)
-
Molecular Construction
-
N-term
-
GST
-
LGALS7 (S2-F136)
Accession # P47929 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALS7; Galectin-7; Galectin 7; TP53I1; LGALS7A; P53-Induced Gene 1 Protein; GAL7; HKL-14; PIG1; Gal-7; Lectin, Galactoside-Binding, Soluble, 7; PI7
-
AA Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
-
Predicted Molecular Mass
41.8 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
