1. Recombinant Proteins
  2. Others
  3. Galectin-7/LGALS7 Protein, Human (GST)

Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag.

Background

Galectin-7, also known as LGALS7, is a protein potentially involved in critical cell-cell and/or cell-matrix interactions essential for normal growth control. Functioning as a pro-apoptotic protein, Galectin-7 operates intracellularly upstream of JNK activation and cytochrome c release, suggesting its role in apoptotic pathways. It exists as a monomer, and its involvement in cellular interactions and apoptotic processes underscores its significance in regulating cell growth and survival. Understanding the functions of Galectin-7 provides valuable insights into the intricate molecular mechanisms governing normal cellular processes and apoptotic signaling.

Species

Human

Source

E. coli

Tag

N-GST

Accession

P47929 (S2-F136)

Gene ID
Molecular Construction
N-term
GST
LGALS7 (S2-F136)
Accession # P47929
C-term
Protein Length

Partial

Synonyms
Galectin-7; Gal-7; HKL-14; PI7; LGALS7; PIG1; LGALS7B
AA Sequence

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Predicted Molecular Mass
41.8 kDa
Molecular Weight

Approximately 40 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Galectin-7/LGALS7 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Galectin-7/LGALS7 Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Galectin-7/LGALS7 Protein, Human (GST)
Cat. No.:
HY-P73071
Quantity:
MCE Japan Authorized Agent: