Galectin-7/LGALS7 Protein, Human (GST)

Galectin-7 (LGALS7), a protein with potential involvement in cell-cell and/or cell-matrix interactions crucial for normal growth control, serves as a pro-apoptotic factor. It functions intracellularly, playing a role upstream of JNK activation and cytochrome c release, thus contributing to apoptotic pathways. Galectin-7 exists as a monomer, highlighting its individual unit structure. Galectin-7/LGALS7 Protein, Human (GST) is the recombinant human-derived Galectin-7/LGALS7 protein, expressed by E. coli , with N-GST labeled tag. The total length of Galectin-7/LGALS7 Protein, Human (GST) is 135 a.a., with molecular weight of ~41.8 kDa.

Galectin-7, also known as LGALS7, is a protein potentially involved in critical cell-cell and/or cell-matrix interactions essential for normal growth control. Functioning as a pro-apoptotic protein, Galectin-7 operates intracellularly upstream of JNK activation and cytochrome c release, suggesting its role in apoptotic pathways. It exists as a monomer, and its involvement in cellular interactions and apoptotic processes underscores its significance in regulating cell growth and survival. Understanding the functions of Galectin-7 provides valuable insights into the intricate molecular mechanisms governing normal cellular processes and apoptotic signaling.

Human

E. coli

N-GST

P47929 (S2-F136)

3963  [NCBI]/653499  [NCBI]

SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Approximately 41.8 kDa

Greater than 90% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.