Galectin-9/LGALS9 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by HEK293, with C-Avi;C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Galectin-9/LGALS9 Protein acts as an eosinophil chemoattractant, recruiting and migrating eosinophils, key immune cells in inflammatory responses. It also serves as an angiogenesis inhibitor, regulating blood vessel formation and impacting vascular processes. Functioning as a regulatory modulator, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways. Galectin-9/LGALS9, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived Galectin-9/LGALS9 protein, expressed by HEK293, with C-Avi;C-His labeled tag.
Background
Galectin-9/LGALS9 protein functions as an eosinophil chemoattractant, actively participating in the recruitment and migration of eosinophils, crucial immune cells involved in inflammatory responses. Moreover, it serves as an angiogenesis inhibitor, contributing to the regulation of blood vessel formation and impacting vascular processes. In its role as a regulatory modulator of immune responses, Galectin-9/LGALS9 suppresses interferon-gamma (IFNG) production by natural killer cells, exerting control over immune signaling pathways (By similarity).
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Biotinylated Human Galectin-9, His,Avitag at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Recombinant Antibody Service-Anti-Gal9 Antibody,Human IgG4 L445P-Kappa with a linear range of 0.06-8 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Avi;N-His
-
Accession
O00182-2 (A2-T323)
-
Gene ID3965
-
Molecular Construction
-
N-term
-
His-Avi
-
LGALS9 (M1-T323)
Accession # O00182-2 -
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Conjugation
Biotin
-
Synonyms
LGALS9; Ecalectin; Galectin 9; Gal-9; LGALS9A; Urate Transporter/Channel Protein; Lectin, Galactoside-Binding, Soluble, 9; Galectin; Tumor Antigen HOM-HD-21; HUAT; Galectin-9
-
AA Sequence
MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
-
Predicted Molecular Mass
39.3 kDa
-
Molecular Weight
Approximately 52-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of 20 mM MOPS, 50 mM Nacl, pH7.4 with trehalose as protectant.
/
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
