Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His)
Gamma-hemolysin component B (HLgB) acts as a toxin, creating cell membrane pores with hemolytic and leukotoxic activities. Furthermore, HLgB promotes AMFR-mediated inflammation by promoting “Lys-27” linked ubiquitination of TAB3, mediating TAK1-TAB3 complex formation, and activating NF-kappa-B signaling. Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Gamma-hemolysin component B protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Staphylococcus aureus
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Gamma-hemolysin component B (HLgB) acts as a toxin, creating cell membrane pores with hemolytic and leukotoxic activities. Furthermore, HLgB promotes AMFR-mediated inflammation by promoting “Lys-27” linked ubiquitination of TAB3, mediating TAK1-TAB3 complex formation, and activating NF-kappa-B signaling. Gamma-hemolysin component B Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Gamma-hemolysin component B protein, expressed by P. pastoris , with N-His labeled tag.
Background
Gamma-hemolysin component B (HlgB) functions as a toxin, exerting its effects by forming pores in the cell membrane and displaying hemolytic and leucotoxic activities. Additionally, HlgB plays a role in promoting host AMFR-mediated inflammation by facilitating 'Lys-27'-linked ubiquitination of TAB3, mediating TAK1-TAB3 complex formation, and phosphorylating TAK1/MAP3K7, thereby activating the host NF-kappa-B signaling pathway. The toxicity of HlgB relies on the sequential binding and synergistic association of a class S and a class F component, leading to the formation of heterooligomeric complexes. Specifically, HlgB (class F) associates either with HlgA, forming an AB toxin, or with HlgC, forming a CB toxin. These interactions and activities underscore the multifaceted nature of HlgB in cellular processes and host-pathogen interactions.
Technical Parameters
-
Species Staphylococcus aureus
-
Source P. pastoris
-
Tag N-His
-
Accession
P0A075 (A26-K325)
-
Gene ID59701249
-
Molecular Construction
-
N-term
-
His
-
hlgB (A26-K325)
Accession # P0A075 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Gamma-hemolysin component B; H-gamma-1; H-gamma-I; hlgB; SA2209
-
AA Sequence
AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
-
Predicted Molecular Mass
36.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
