GCSH Protein, Human (His)
Based on 1 Customer Validation
GCSH protein, a vital component of the glycine cleavage system, efficiently shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST), contributing to glycine degradation. GCSH Protein, Human (His) is the recombinant human-derived GCSH protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
보관:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
GCSH protein, a vital component of the glycine cleavage system, efficiently shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST), contributing to glycine degradation. GCSH Protein, Human (His) is the recombinant human-derived GCSH protein, expressed by E. coli , with N-His labeled tag.
The glycine cleavage system, facilitated by the glycine cleavage system H protein (GCSH), is integral to the degradation of glycine. In this process, GCSH plays a crucial role by efficiently shuttling the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P23434 (S49-E173)
-
Molecular Construction
-
N-term
-
His
-
GCSH (S49-E173)
Accession # P23434 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Glycine cleavage system H protein, mitochondrial; Lipoic acid-containing protein; GCSH
-
AA Sequence
SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE
-
분자량
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
각종 서류
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)