1. Recombinant Proteins
  2. Others
  3. GCSH Protein, Human (His)

GCSH protein, a vital component of the glycine cleavage system, efficiently shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST), contributing to glycine degradation. GCSH Protein, Human (His) is the recombinant human-derived GCSH protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GCSH protein, a vital component of the glycine cleavage system, efficiently shuttles the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST), contributing to glycine degradation. GCSH Protein, Human (His) is the recombinant human-derived GCSH protein, expressed by E. coli , with N-His labeled tag.

Background

The glycine cleavage system, facilitated by the glycine cleavage system H protein (GCSH), is integral to the degradation of glycine. In this process, GCSH plays a crucial role by efficiently shuttling the methylamine group of glycine from the P protein (GLDC) to the T protein (GCST).

Species

Human

Source

E. coli

Tag

N-His

Accession

P23434 (S49-E173)

Gene ID
Molecular Construction
N-term
His
GCSH (S49-E173)
Accession # P23434
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Glycine cleavage system H protein, mitochondrial; Lipoic acid-containing protein; GCSH
AA Sequence

SVRKFTEKHEWVTTENGIGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLSNPSELDELMSEEAYEKYIKSIEE

Molecular Weight

Approximately 17 kDa.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GCSH Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GCSH Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GCSH Protein, Human (His)
Cat. No.:
HY-P76358
Quantity:
MCE Japan Authorized Agent: