GIPR Protein, Cynomolgus (Biotinylated, HEK293, His, Avi)
Based on 1 Customer Validation
GIPR Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived GIPR protein, expressed by HEK293, with C-Avi & C-His tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GIPR Protein, Cynomolgus (Biotinylated, HEK293, His, Avi) is the recombinant cynomolgus-derived GIPR protein, expressed by HEK293, with C-Avi & C-His tag.
Background
The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.
Verified Bioactivity
Immobilized Biotinylated Cynomolgus GIPR, His Avi Tag at 0.5 μg/mL (100 μL/well) on the streptavidin precoated plate (5 μg/mL). Dose response curve for Anti-GIPR Antibody, hFc Tag. The EC50 for this effect is 1.0-15.0 ng/mL.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
XP_005589662.2 (G26-Q138)
-
Gene ID102123760
-
Molecular Construction
-
N-term
-
GIPR (G26-Q138)
Accession # XP_005589662.2 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
GIPR; GIP-R; Gastric Inhibitory Polypeptide Receptor; PGQTL2; Glucose-Dependent Insulinotropic Polypeptide Receptor
-
AA Sequence
GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
