GIPR Protein, Cynomolgus (HEK293, His, Avi)
Based on 1 Customer Validation
GIPR Protein, Cynomolgus (HEK293, His, Avi) is the recombinant cynomolgus-derived GIPR protein, expressed by HEK293, with C-His & Avi tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GIPR Protein, Cynomolgus (HEK293, His, Avi) is the recombinant cynomolgus-derived GIPR protein, expressed by HEK293, with C-His & Avi tag.
Background
The GIPR protein functions as a receptor for glucose-dependent insulinotropic polypeptide (GIP). Its activity is mediated by G proteins, specifically those that activate adenylyl cyclase. Notably, GIPR has the potential to form homodimers and heterodimers with GLP1R, suggesting a possible interaction between receptors associated with incretin hormones.
Verified Bioactivity
Immobilized Cynomolgus GIPR, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Anti-GIPR Antibody, hFc Tag with the EC50 of 5.1 ng/mL determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His;Avi
-
Accession
XP_005589662 (G26-Q138)
-
Gene ID/
-
Protein Length
Extracellular Domain
-
Synonyms
GIPR; GIP-R; Gastric Inhibitory Polypeptide Receptor; PGQTL2; Glucose-Dependent Insulinotropic Polypeptide Receptor
-
AA Sequence
GSEGQTAGELYQRWERYRRECQETLATAEPPSGLACNGSFDMYVCWNYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
