GMNN Protein, Human

GMNN proteins are important inhibitors of DNA replication and prevent the incorporation of MCM complexes into prereplication complexes. During mitosis, GMNN undergoes degradation, enabling replication in subsequent cell cycles. GMNN Protein, Human is the recombinant human-derived GMNN protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GMNN proteins are important inhibitors of DNA replication and prevent the incorporation of MCM complexes into prereplication complexes. During mitosis, GMNN undergoes degradation, enabling replication in subsequent cell cycles. GMNN Protein, Human is the recombinant human-derived GMNN protein, expressed by E. coli , with tag free.

Background

GMNN protein functions as a key inhibitor of DNA replication by preventing the incorporation of the MCM complex into the pre-replication complex (pre-RC). It undergoes degradation during the mitotic phase, enabling replication in the subsequent cell cycle. Additionally, GMNN inhibits the histone acetyltransferase activity of KAT7/HBO1 in a CDT1-dependent manner, suppressing histone H4 acetylation and DNA replication licensing. It also plays a role in controlling the transcriptional activity of a subset of Hox proteins, linking them to cell proliferation regulation. GMNN forms homotetramers and interacts with CDT1, existing in both 'permissive' heterotrimers and 'inhibitory' heterohexamers. The protein interacts with IDAS, directing GMNN to the nucleus, and forms a heterodimer with MCIDAS, which has lower affinity for CDT1 compared to the GMNN homodimer. Furthermore, GMNN engages in interactions with a subset of Hox proteins, with varying affinities, and interacts with LRWD1 from G1/S to mitosis.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GMNN (M1-I209)
      Accession # O75496
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GMNN; Geminin; Geminin DNA Replication Inhibitor; MGORS6; Gem

  • AA Sequence

    MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00