1. Recombinant Proteins
  2. Others
  3. GMNN Protein, Human

GMNN proteins are important inhibitors of DNA replication and prevent the incorporation of MCM complexes into prereplication complexes. During mitosis, GMNN undergoes degradation, enabling replication in subsequent cell cycles. GMNN Protein, Human is the recombinant human-derived GMNN protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GMNN proteins are important inhibitors of DNA replication and prevent the incorporation of MCM complexes into prereplication complexes. During mitosis, GMNN undergoes degradation, enabling replication in subsequent cell cycles. GMNN Protein, Human is the recombinant human-derived GMNN protein, expressed by E. coli , with tag free.

Background

GMNN protein functions as a key inhibitor of DNA replication by preventing the incorporation of the MCM complex into the pre-replication complex (pre-RC). It undergoes degradation during the mitotic phase, enabling replication in the subsequent cell cycle. Additionally, GMNN inhibits the histone acetyltransferase activity of KAT7/HBO1 in a CDT1-dependent manner, suppressing histone H4 acetylation and DNA replication licensing. It also plays a role in controlling the transcriptional activity of a subset of Hox proteins, linking them to cell proliferation regulation. GMNN forms homotetramers and interacts with CDT1, existing in both 'permissive' heterotrimers and 'inhibitory' heterohexamers. The protein interacts with IDAS, directing GMNN to the nucleus, and forms a heterodimer with MCIDAS, which has lower affinity for CDT1 compared to the GMNN homodimer. Furthermore, GMNN engages in interactions with a subset of Hox proteins, with varying affinities, and interacts with LRWD1 from G1/S to mitosis.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

O75496 (M1-I209)

Gene ID

51053

Molecular Construction
N-term
GMNN (M1-I209)
Accession # O75496
C-term
Protein Length

Full Length

Synonyms
GMNN; Geminin
AA Sequence

MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GMNN Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GMNN Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMNN Protein, Human
Cat. No.:
HY-P701849
Quantity:
MCE Japan Authorized Agent: