GMNN Protein, Human
GMNN proteins are important inhibitors of DNA replication and prevent the incorporation of MCM complexes into prereplication complexes. During mitosis, GMNN undergoes degradation, enabling replication in subsequent cell cycles. GMNN Protein, Human is the recombinant human-derived GMNN protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
GMNN proteins are important inhibitors of DNA replication and prevent the incorporation of MCM complexes into prereplication complexes. During mitosis, GMNN undergoes degradation, enabling replication in subsequent cell cycles. GMNN Protein, Human is the recombinant human-derived GMNN protein, expressed by E. coli , with tag free.
Background
GMNN protein functions as a key inhibitor of DNA replication by preventing the incorporation of the MCM complex into the pre-replication complex (pre-RC). It undergoes degradation during the mitotic phase, enabling replication in the subsequent cell cycle. Additionally, GMNN inhibits the histone acetyltransferase activity of KAT7/HBO1 in a CDT1-dependent manner, suppressing histone H4 acetylation and DNA replication licensing. It also plays a role in controlling the transcriptional activity of a subset of Hox proteins, linking them to cell proliferation regulation. GMNN forms homotetramers and interacts with CDT1, existing in both 'permissive' heterotrimers and 'inhibitory' heterohexamers. The protein interacts with IDAS, directing GMNN to the nucleus, and forms a heterodimer with MCIDAS, which has lower affinity for CDT1 compared to the GMNN homodimer. Furthermore, GMNN engages in interactions with a subset of Hox proteins, with varying affinities, and interacts with LRWD1 from G1/S to mitosis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
O75496 (M1-I209)
-
Gene ID51053
-
Molecular Construction
-
N-term
-
GMNN (M1-I209)
Accession # O75496 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GMNN; Geminin; Geminin DNA Replication Inhibitor; MGORS6; Gem
-
AA Sequence
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)