GMP FLT3LG Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. GMP FLT3LG Protein, Human (HEK293, His) is the recombinant human-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. GMP FLT3LG Protein, Human (HEK293, His) is the recombinant human-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.

Background

FLT3LG protein serves as a potent stimulator of early hematopoietic cell proliferation through the activation of FLT3, demonstrating synergistic effects when combined with various colony-stimulating factors and interleukins. This homodimeric protein, particularly in isoform 2, plays a crucial role in promoting the expansion and differentiation of hematopoietic progenitor cells. Its ability to activate FLT3 and collaborate with other signaling molecules underscores its significance in regulating hematopoiesis and maintaining the balance of the hematopoietic system.

Verified Bioactivity

Immobilized Human Flt-3 Ligand at 5 μg/mL (100 μL/well) can bind Human FLT3 (C-Fc).The specific activity is >1×106 U/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GMP FLT3LG (T27-P184)
      Accession # P49771-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    FLT3LG; IMD125; Fms Related Receptor Tyrosine Kinase 3 Ligand; FLG3L; Fms-Related Tyrosine Kinase 3 Ligand; FLT3L; Fms Related Tyrosine Kinase 3 Ligand; Flt3L; Flt3 Ligand; FL; SL Cytokine

  • AA Sequence

    TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP

  • Predicted Molecular Mass

    19 kDa

  • Molecular Weight

    Approximately 24-32 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.05 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00