GMP FLT3LG Protein, Human (HEK293, His)
Based on 1 Customer Validation
FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. GMP FLT3LG Protein, Human (HEK293, His) is the recombinant human-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FLT3LG protein, a potent stimulator of early hematopoietic cell proliferation, activates FLT3 and synergizes with colony-stimulating factors and interleukins. As a homodimer, especially in isoform 2, it crucially promotes expansion and differentiation of hematopoietic progenitor cells. FLT3LG's collaborative signaling with other molecules underscores its significance in regulating hematopoiesis and maintaining hematopoietic system balance. GMP FLT3LG Protein, Human (HEK293, His) is the recombinant human-derived FLT3LG protein, expressed by HEK293 , with C-6*His labeled tag.
Background
FLT3LG protein serves as a potent stimulator of early hematopoietic cell proliferation through the activation of FLT3, demonstrating synergistic effects when combined with various colony-stimulating factors and interleukins. This homodimeric protein, particularly in isoform 2, plays a crucial role in promoting the expansion and differentiation of hematopoietic progenitor cells. Its ability to activate FLT3 and collaborate with other signaling molecules underscores its significance in regulating hematopoiesis and maintaining the balance of the hematopoietic system.
Verified Bioactivity
Immobilized Human Flt-3 Ligand at 5 μg/mL (100 μL/well) can bind Human FLT3 (C-Fc).The specific activity is >1×106 U/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P49771-1 (T27-P184)
-
Molecular Construction
-
N-term
-
GMP FLT3LG (T27-P184)
Accession # P49771-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FLT3LG; IMD125; Fms Related Receptor Tyrosine Kinase 3 Ligand; FLG3L; Fms-Related Tyrosine Kinase 3 Ligand; FLT3L; Fms Related Tyrosine Kinase 3 Ligand; Flt3L; Flt3 Ligand; FL; SL Cytokine
-
AA Sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
-
Predicted Molecular Mass
19 kDa
-
Molecular Weight
Approximately 24-32 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.05 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in injection water.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)