1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GOX2015 Protein, Gluconobacter oxydans (His, StrepⅡ)

GOX2015 Protein, Gluconobacter oxydans (His, StrepⅡ)

Cat. No.: HY-P702124
Handling Instructions Technical Support

The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans (His, Strep) is the recombinant GOX2015 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans (His, Strep) is the recombinant GOX2015 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

GOX2015 Protein exhibits the capability to oxidize both D-glucose and D-mannose, displaying a distinct preference for the latter with a catalytic efficiency approximately 15 times greater than that observed with glucose. This enzymatic activity is strictly reliant on the presence of NADP, emphasizing its crucial role as a cofactor for the oxidation process. The substrate specificity and dependence on NADP underscore the unique biochemical characteristics of GOX2015, shedding light on its potential functional significance in cellular metabolic pathways.

Species

Others

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

Q5FPE5 (P2-S266)

Gene ID

/

Molecular Construction
N-term
StrepⅡ-6*His
GOX2015 (P2-S266)
Accession # Q5FPE5
C-term
Protein Length

Partial

Synonyms
Glucose 1-dehydrogenase
AA Sequence

PAPYKDRFAGKKVLVTGASQGIGEATALRFAEEGAQVALNGRKEDKLIAVREKLPKVSGGEHPIATGDISKEDDVKRLVAESIKAMGGLDVLVCNAGYQIPSPSEDIKLEDFEGVMAVNVTGVMLPCREVIRYWLENGIKGTIIVNSSVHQIIPKPHYLGYSASKGAVGNIVRTLALEYATRGIRVNAVAPGAIVTPINMSWIDDPEQYKAVSSHIPMKRPGESREIADAITFLAAEDSTYITGQTLYVDGGLTLYGDFENNWSS

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GOX2015 Protein, Gluconobacter oxydans (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GOX2015 Protein, Gluconobacter oxydans (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GOX2015 Protein, Gluconobacter oxydans (His, StrepⅡ)
Cat. No.:
HY-P702124
Quantity:
MCE Japan Authorized Agent: