GOX2015 Protein, Gluconobacter oxydans (His, StrepⅡ)
The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans (His, Strep) is the recombinant GOX2015 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GOX2015 protein showed a significant ability to oxidize D-glucose and D-mannose, showing a clear 15-fold preference for the latter. This catalytic efficiency is strictly dependent on the presence of NADP, emphasizing its important role as an oxidative cofactor. GOX2015 Protein, Gluconobacter oxydans (His, Strep) is the recombinant GOX2015 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
Background
GOX2015 Protein exhibits the capability to oxidize both D-glucose and D-mannose, displaying a distinct preference for the latter with a catalytic efficiency approximately 15 times greater than that observed with glucose. This enzymatic activity is strictly reliant on the presence of NADP, emphasizing its crucial role as a cofactor for the oxidation process. The substrate specificity and dependence on NADP underscore the unique biochemical characteristics of GOX2015, shedding light on its potential functional significance in cellular metabolic pathways.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-StrepⅡ;N-6*His
-
Accession
Q5FPE5 (P2-S266)
-
Gene ID/
-
Molecular Construction
-
N-term
-
StrepⅡ-6*His
-
GOX2015 (P2-S266)
Accession # Q5FPE5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
Glucose 1-dehydrogenase; EC:1.1.1.119; GOX2016
-
AA Sequence
PAPYKDRFAGKKVLVTGASQGIGEATALRFAEEGAQVALNGRKEDKLIAVREKLPKVSGGEHPIATGDISKEDDVKRLVAESIKAMGGLDVLVCNAGYQIPSPSEDIKLEDFEGVMAVNVTGVMLPCREVIRYWLENGIKGTIIVNSSVHQIIPKPHYLGYSASKGAVGNIVRTLALEYATRGIRVNAVAPGAIVTPINMSWIDDPEQYKAVSSHIPMKRPGESREIADAITFLAAEDSTYITGQTLYVDGGLTLYGDFENNWSS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
