GPHA2 Protein, Human (HEK293, Fc)
GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, Fc) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, Fc) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
GPHA2 (Glycoprotein Hormone Alpha 2) functions as a crucial heterodimeric glycoprotein hormone alongside GPHB5, with the ability to bind and activate the thyroid-stimulating hormone receptor (TSHR), ultimately resulting in elevated cAMP production. This glycoprotein hormone complex plays a central role in the regulation of thyroid cell metabolism, indicating its significance in the control of thyroid function and hormonal balance. The functional partnership between GPHA2 and GPHB5 is highlighted by their formation of a heterodimer, and this complex specifically interacts with TSHR, thereby initiating the cascade leading to increased cAMP levels.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q96T91 (Q24-Y129)
-
Molecular Construction
-
N-term
-
GPHA2 (Q24-Y129)
Accession # Q96T91 -
mFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GPHA2; Glycoprotein Hormone Alpha-2; Glycoprotein Hormone Subunit Alpha 2; A2; Thyrostimulin Subunit Alpha; Glycoprotein Hormone Alpha 2; ZSIG51; Cysteine Knot Protein; GPA2; Glycoprotein Alpha 2; Putative Secreted Protein Zsig51; MGC126572
-
AA Sequence
QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY
-
Predicted Molecular Mass
38.1 kDa
-
Molecular Weight
Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
