GPHA2 Protein, Human (HEK293, Fc)

GPHA2 acts as a heterodimeric glycoprotein hormone together with GPHB5 to form a complex that binds and activates the thyroid-stimulating hormone receptor (TSHR), thereby triggering elevated cAMP production. This protein complex plays a key role in the regulation of thyroid cell metabolism, controlling the basic metabolic processes of thyroid cells. GPHA2 Protein, Human (HEK293, Fc) is the recombinant human-derived GPHA2 protein, expressed by HEK293 , with C-mFc labeled tag.

GPHA2 (Glycoprotein Hormone Alpha 2) functions as a crucial heterodimeric glycoprotein hormone alongside GPHB5, with the ability to bind and activate the thyroid-stimulating hormone receptor (TSHR), ultimately resulting in elevated cAMP production. This glycoprotein hormone complex plays a central role in the regulation of thyroid cell metabolism, indicating its significance in the control of thyroid function and hormonal balance. The functional partnership between GPHA2 and GPHB5 is highlighted by their formation of a heterodimer, and this complex specifically interacts with TSHR, thereby initiating the cascade leading to increased cAMP levels.

Human

HEK293

C-mFc

Q96T91 (Q24-Y129)

170589  [NCBI]

Full Length of Mature Protein

QEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY

Approximately 38-43,based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.