GPR20 Protein-VLP, Cynomolgus (HEK293, His)
GPR20 Protein-VLP, Cynomolgus (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
GPR20 Protein-VLP, Cynomolgus (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-10*His
-
Accession
XP_015310747.1 (M1-A359)
-
Gene ID101025052
-
Molecular Construction
-
N-term
-
GPR20-VLPs (M1-A359)
Accession # XP_015310747.1 -
10*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
GPR20; G-Protein Coupled Receptor 20; G Protein-Coupled Receptor 20; CTD-3064M3.3
-
AA Sequence
MPSVSPVGPSAGAVPNATAVTTVWTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLVGLVLNGLALYVFCCRTQAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLHCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGMTGGRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLRQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHASLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHRGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
