Copy Link Print Information

Granzyme B/GZMB Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME). Granzyme B/GZMB Protein, Human (HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Granzyme B/GZMB Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Granzyme B (GZMB) is a cytosolic protease enriched in cytotoxic T cells and natural killer cells and is critical for immune defense. Upon delivery to target cells, GZMB activates caspase-independent pyroptosis by cleaving gasdermin-E (GSDME). Granzyme B/GZMB Protein, Human (HEK293, His) is the recombinant human-derived Granzyme B/GZMB protein, expressed by HEK293, with C-6*His labeled tag.

Background

Granzyme B (GZMB) is a highly abundant protease residing in the cytosolic granules of cytotoxic T-cells and natural killer cells, playing a pivotal role in immune defense mechanisms. Upon delivery into the target cell through the immunological synapse, GZMB activates caspase-independent pyroptosis by catalyzing the cleavage of gasdermin-E (GSDME). This results in the release of the pore-forming moiety of GSDME, triggering pyroptosis and ultimately leading to target cell death. GZMB exhibits a substrate specificity for cleavage after aspartate residues. Additionally, it is implicated in an activation cascade of caspases, including caspase-3, -9, and -10, thereby contributing to apoptosis execution. Moreover, GZMB is involved in the response to bacterial infection, where it cleaves and activates caspase-7, promoting plasma membrane repair. The multifaceted activities of GZMB highlight its crucial role in orchestrating immune responses and cellular defense mechanisms.

Verified Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate, Ac-IETD-pNA. The specific activity is >200 mOD/min/μg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    P10144 (I21-Y247)

  • Gene ID
    3002
  • Molecular Construction
    • N-term
    • Granzyme B/GZMB (I21-Y247)
      Accession # P10144
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GZMB; Granzyme B (Granzyme 2, Cytotoxic T-Lymphocyte-Associated Serine Esterase 1); Prev. CTLA1; Cytotoxic Serine Protease B; Prev. CSPB; Human Lymphocyte Protein; CTSGL1; Fragmentin-2; CGL1; C11; SECT; Cytotoxic T-Lymphocyte-Associated Serine Esterase 1;

  • AA Sequence

    IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY

  • Predicted Molecular Mass

    26.6 kDa

  • Molecular Weight

    Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, 8% Sucrose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Granzyme B/GZMB Protein, Human (HEK293, His) Product Image
    1/16
  • Granzyme B/GZMB Protein, Human (HEK293, His) Product Image