GRHL2 Protein, Human (His, Strep)

GRHL2 Protein, Human (His, Strep) is the recombinant human-derived GRHL2, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GRHL2 Protein, Human (His, Strep) is the recombinant human-derived GRHL2, expressed by E. coli , with Strep, His labeled tag.

Background

GRHL2 is a transcription factor crucial for primary neurulation and epithelial development. It binds directly to the consensus DNA sequence 5'-AACCGGTT-3', acting as either an activator or repressor for distinct target genes (By similarity). During embryogenesis, GRHL2 cooperates with GRHL3 to establish distinct zones of primary neurulation: essential for closure 3 (rostral forebrain), jointly regulates closure 2 (forebrain/midbrain boundary) and posterior neuropore closure with GRHL3 (By similarity). As a transcriptional activator of apical junctional complex components, GRHL2 upregulates CLDN3, CLDN4, and RAB25 to promote epithelial morphogenesis and CLDN4 localization at tight junctions (By similarity). It is a core component of the transcriptional machinery regulating CLDN4 and CDH1 expression across epithelia, exhibiting functional redundancy with GRHL3 in epidermal morphogenesis and wound repair (By similarity). In lung, GRHL2 forms a regulatory loop with NKX2-1 to coordinate epithelial morphogenesis and differentiation (By similarity). In keratinocytes, GRHL2 activates telomerase by binding the TERT promoter and inhibiting 5'-CpG island methylation (potentially via DNMT1 interference), while epigenetically suppressing epidermal differentiation complex (EDC) genes and GRHL1/GRHL3 to impair keratinocyte differentiation and epidermal function.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Strep;His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    GRHL2; Brother-Of-MGR; Prev. TFCP2L3; Deafness, Autosomal Dominant 28; Prev. DFNA28; Grainyhead-Like 2 (Drosophila); BOM; Grainyhead-Like 2; Transcription Factor CP2-Like 3; ECTDS; Grainyhead-Like Protein 2 Homolog; PPCD4; Brother Of Mammalian Grainyhead;

  • AA Sequence

    SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKGAERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANLQR

  • Predicted Molecular Mass

    34.9 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00