GRHL2 Protein, Human (His, Strep)
GRHL2 Protein, Human (His, Strep) is the recombinant human-derived GRHL2, expressed by E. coli , with Strep, His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
GRHL2 Protein, Human (His, Strep) is the recombinant human-derived GRHL2, expressed by E. coli , with Strep, His labeled tag.
Background
GRHL2 is a transcription factor crucial for primary neurulation and epithelial development. It binds directly to the consensus DNA sequence 5'-AACCGGTT-3', acting as either an activator or repressor for distinct target genes (By similarity). During embryogenesis, GRHL2 cooperates with GRHL3 to establish distinct zones of primary neurulation: essential for closure 3 (rostral forebrain), jointly regulates closure 2 (forebrain/midbrain boundary) and posterior neuropore closure with GRHL3 (By similarity). As a transcriptional activator of apical junctional complex components, GRHL2 upregulates CLDN3, CLDN4, and RAB25 to promote epithelial morphogenesis and CLDN4 localization at tight junctions (By similarity). It is a core component of the transcriptional machinery regulating CLDN4 and CDH1 expression across epithelia, exhibiting functional redundancy with GRHL3 in epidermal morphogenesis and wound repair (By similarity). In lung, GRHL2 forms a regulatory loop with NKX2-1 to coordinate epithelial morphogenesis and differentiation (By similarity). In keratinocytes, GRHL2 activates telomerase by binding the TERT promoter and inhibiting 5'-CpG island methylation (potentially via DNMT1 interference), while epigenetically suppressing epidermal differentiation complex (EDC) genes and GRHL1/GRHL3 to impair keratinocyte differentiation and epidermal function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q6ISB3-1 (S217-R492)
-
Gene ID79977
-
Protein Length
Partial
-
Synonyms
GRHL2; Brother-Of-MGR; Prev. TFCP2L3; Deafness, Autosomal Dominant 28; Prev. DFNA28; Grainyhead-Like 2 (Drosophila); BOM; Grainyhead-Like 2; Transcription Factor CP2-Like 3; ECTDS; Grainyhead-Like Protein 2 Homolog; PPCD4; Brother Of Mammalian Grainyhead;
-
AA Sequence
SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKGAERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANLQR
-
Predicted Molecular Mass
34.9 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)