1. Recombinant Proteins
  2. Others
  3. GRHL2 Protein, Human (His, Strep)

GRHL2 Protein, Human (His, Strep) is the recombinant human-derived GRHL2, expressed by E. coli , with Strep, His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRHL2 Protein, Human (His, Strep) is the recombinant human-derived GRHL2, expressed by E. coli , with Strep, His labeled tag.

Background

GRHL2 is a transcription factor crucial for primary neurulation and epithelial development. It binds directly to the consensus DNA sequence 5'-AACCGGTT-3', acting as either an activator or repressor for distinct target genes (By similarity). During embryogenesis, GRHL2 cooperates with GRHL3 to establish distinct zones of primary neurulation: essential for closure 3 (rostral forebrain), jointly regulates closure 2 (forebrain/midbrain boundary) and posterior neuropore closure with GRHL3 (By similarity). As a transcriptional activator of apical junctional complex components, GRHL2 upregulates CLDN3, CLDN4, and RAB25 to promote epithelial morphogenesis and CLDN4 localization at tight junctions (By similarity). It is a core component of the transcriptional machinery regulating CLDN4 and CDH1 expression across epithelia, exhibiting functional redundancy with GRHL3 in epidermal morphogenesis and wound repair (By similarity). In lung, GRHL2 forms a regulatory loop with NKX2-1 to coordinate epithelial morphogenesis and differentiation (By similarity). In keratinocytes, GRHL2 activates telomerase by binding the TERT promoter and inhibiting 5'-CpG island methylation (potentially via DNMT1 interference), while epigenetically suppressing epidermal differentiation complex (EDC) genes and GRHL1/GRHL3 to impair keratinocyte differentiation and epidermal function.

Species

Human

Source

E. coli

Tag

Strep;His

Accession

Q6ISB3-1 (S217-R492)

Gene ID

79977

Protein Length

Partial

Synonyms
BOM; TFCP2L3
AA Sequence

SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITLSETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEIAYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKGAERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANLQR

Predicted Molecular Mass
34.9 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

GRHL2 Protein, Human (His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GRHL2 Protein, Human (His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRHL2 Protein, Human (His, Strep)
Cat. No.:
HY-P703364
Quantity:
MCE Japan Authorized Agent: