GRO-alpha/CXCL1 Protein, Human (HEK293, hFc)
GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (HEK293, hFc) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (HEK293, hFc) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by HEK293, with C-hFc labeled tag.
Background
GRO-alpha/CXCL1 protein exhibits chemotactic activity for neutrophils and may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. In vitro studies indicate that processed forms of GRO-alpha, namely GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), display a significantly enhanced chemotactic activity, being 30-fold higher compared to the full-length protein.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P09341 (A35-N107)
-
Gene ID2919
-
Molecular Construction
-
N-term
-
CXCL1 (A35-N107)
Accession # P09341 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL1; Neutrophil-Activating Protein 3; Prev. GRO1; Fibroblast Secretory Protein; Prev. MGSA; C-X-C Motif Chemokine 1; Prev. FSP; GRO-Alpha(1-73); SCYB1; GRO1 Oncogene (Melanoma Growth-Stimulating Activity); NAP-3; Melanoma Growth Stimulatory Activity Alp
-
AA Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
-
Predicted Molecular Mass
34.3 kDa
-
Molecular Weight
Approximately 37-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
