GSTM5 Protein, Human (N-His)
Based on 1 Customer Validation
GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GSTM5 protein is pivotal in conjugating reduced glutathione to diverse hydrophobic electrophiles, crucial for cellular detoxification. Its enzymatic activity, addressing both exogenous and endogenous compounds, is essential for eliminating harmful substances and maintaining cellular homeostasis, highlighting GSTM5's protective role against toxic insults. GSTM5 Protein, Human (N-His) is the recombinant human-derived GSTM5 protein, expressed by E. coli , with N-6*His labeled tag.
Background
GSTM5 protein plays a pivotal role in the cellular process of conjugating reduced glutathione to a broad spectrum of hydrophobic electrophiles, both originating from the cellular environment and generated endogenously. This enzymatic activity is fundamental for the detoxification and elimination of various harmful compounds within the cell, showcasing the essential role of GSTM5 in maintaining cellular homeostasis and protecting against potential toxic insults.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P46439 (M1-K218)
-
Molecular Construction
-
N-term
-
6*His
-
GSTM5 (M1-K218)
Accession # P46439 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GSTM5; S-(Hydroxyalkyl)Glutathione Lyase M5; Glutathione S-Transferase Mu 5; Glutathione S-Aralkyltransferase M5; Glutathione S-Transferase M5; Glutathione S-Alkyltransferase M5; GST Class-Mu 5; Glutathione S-Aryltransferase M5; GSTM5-5; Glutathione S-Tra
-
AA Sequence
MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
