Copy Link Print Information

HCoV-OC43 Nucleoprotein/NP Protein (His)

Customer Review

Based on 1 Customer Validation

HCoV-OC43 Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. HCoV-OC43 Nucleoprotein/NP Protein (His) is the recombinant Virus-derived HCoV-OC43 Nucleoprotein/NP protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • HCoV-OC43 Nucleoprotein/NP Protein (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

HCoV-OC43 Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. HCoV-OC43 Nucleoprotein/NP Protein (His) is the recombinant Virus-derived HCoV-OC43 Nucleoprotein/NP protein, expressed by E. coli , with N-His labeled tag.

Background

HCoV-OC43 Nucleoprotein (NP, N) is a homodimer composed of 448 amino acids in each chain. NP can be divided into two structural domains interspersed with disordered (unstructured) regions: the N-terminal domain (NTD; also called RBD) serves as a putative RNA-binding domain, while the C-terminal domain (CTD; also called DD) is a dimerization domain, both the NTD and the CTD bind to nucleic acids through electropositive regions on their surfaces.
NP is one of the most abundant coronavirus proteins with nonspecific binding activity toward nucleic acids, including ssRNA, single-stranded DNA, and double-stranded DNA, NP can also act as an RNA chaperone. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. NP plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication[1].

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-His
  • Accession

    YP_009555245.1 (M1-I448)

  • Gene ID
    39105221  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • HCoV-OC43 NP (M1-I448)
      Accession # YP_009555245.1
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Human coronavirus (HCoV-OC43) Nucleocapsid Protein (His)

  • AA Sequence

    MSFTPGKQSSSRASSGNRSGNGILKWADQSDQFRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

  • Predicted Molecular Mass

    50.4 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 40 mM PB, 500 mM NaCl, pH 7.4.

Endotoxin Level

/

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • HCoV-OC43 Nucleoprotein/NP Protein (His) Product Image
    1/16
  • HCoV-OC43 Nucleoprotein/NP Protein (His) Product Image