HCoV-OC43 Nucleoprotein/NP Protein (His)

HCoV-OC43 Nucleoprotein (NP, N) is a homodimer with nonspecific binding activity toward nucleic acids. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly, enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication through its interactions with the viral genome and membrane protein M. HCoV-OC43 Nucleoprotein/NP Protein (His) is the recombinant Virus-derived HCoV-OC43 Nucleoprotein/NP protein, expressed by E. coli , with N-His labeled tag.

HCoV-OC43 Nucleoprotein (NP, N) is a homodimer composed of 448 amino acids in each chain. NP can be divided into two structural domains interspersed with disordered (unstructured) regions: the N-terminal domain (NTD; also called RBD) serves as a putative RNA-binding domain, while the C-terminal domain (CTD; also called DD) is a dimerization domain, both the NTD and the CTD bind to nucleic acids through electropositive regions on their surfaces.
NP is one of the most abundant coronavirus proteins with nonspecific binding activity toward nucleic acids, including ssRNA, single-stranded DNA, and double-stranded DNA, NP can also act as an RNA chaperone. NP packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. NP plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication^[1].

Virus

E. coli

N-His

YP_009555245.1 (M1-I448)

39105221  [NCBI]

Full Length

MSFTPGKQSSSRASSGNRSGNGILKWADQSDQFRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGVPIAPGVPATEAKGYWYRHNRRSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 40 mM PB, 500 mM NaCl, pH 7.4.

/

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.