7α‐HSDH Protein, E.coli (His, Strep)

7α‐HSDH Protein, E.coli (His, Strep) is the recombinant E.coli-derived 7α‐HSDH protein, expressed by E. coli, with Strep & His tag.

7α-HSDH is a 7alpha-hydroxysteroid dehydrogenase involved in bile acid metabolism. It catalyzes the NAD(+)-dependent oxidation of the 7alpha-hydroxy group of 7alpha-hydroxysteroids, such as the major human bile acids cholate and chenodeoxycholate, to the corresponding 7-oxosteroids. It can also act, though less efficiently, on taurochenodeoxycholate, taurocholate, and glycocholate. By similar function, it can use glycochenodeoxycholate as a substrate but cannot utilize NADP(+) instead of NAD(+) as the electron acceptor.

E.coli

E. coli

Strep;His

P0AET8 (F2-N255)

75171679

Partial

FNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN

Approximately 29 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 5% glycerol.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.