7α‐HSDH Protein, E.coli (His, Strep)
Based on 1 Customer Validation
7α‐HSDH Protein, E.coli (His, Strep) is the recombinant E.coli-derived 7α‐HSDH protein, expressed by E. coli, with Strep & His tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
7α‐HSDH Protein, E.coli (His, Strep) is the recombinant E.coli-derived 7α‐HSDH protein, expressed by E. coli, with Strep & His tag.
Background
7α-HSDH is a 7alpha-hydroxysteroid dehydrogenase involved in bile acid metabolism. It catalyzes the NAD(+)-dependent oxidation of the 7alpha-hydroxy group of 7alpha-hydroxysteroids, such as the major human bile acids cholate and chenodeoxycholate, to the corresponding 7-oxosteroids. It can also act, though less efficiently, on taurochenodeoxycholate, taurocholate, and glycocholate. By similar function, it can use glycochenodeoxycholate as a substrate but cannot utilize NADP(+) instead of NAD(+) as the electron acceptor.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag Strep;His
-
Accession
P0AET8 (F2-N255)
-
Gene ID75171679
-
Protein Length
Full Length
-
Synonyms
7alpha-hydroxysteroid dehydrogenase; EC:1.1.1.159; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; hsdH; hdhA; b1619; JW1611
-
AA Sequence
FNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQELN
-
Predicted Molecular Mass
29.8 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 8.0, 150 mM NaCl, 5% glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)