Hemojuvelin Protein, Cynomolgus (sf9, His)

The Hemojuvelin protein is a membrane-bound and soluble protein in mammals, also known as rejection directing Molecule C (RGMc) or hemochromatosis type 2 protein (HFE2). Hemojuvelin works by inhibiting the MAPK-JNK pathway that inhibits the growth, adhesion, migration, and invasion of prostate cancer cells. Hemojuvelin Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived Hemojuvelin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Hemoglobinin (HJV), also known as rejection guide Molecule C (RGMc) or hemochromatosis type 2 protein (HFE2), is a membrane-binding and soluble protein in mammals that is responsible for the iron overload condition known as juvenile hemochromatosis in humans, which is a severe form of hemochromatosis. Hemojuvelin may play an inhibitory role by inhibiting the growth, adhesion, migration, and invasion of prostate cancer cells. In prostate and breast cancer cells, Hemojuvelin regulates both SMAD-dependent and SMAD-independent bone morphogenetic protein (BMP) signaling by inhibiting MAPK-JNK pathways^[1][2][3].

Cynomolgus

Sf9 insect cells

C-His

EHH15137 (Q36-S400)

698805  [NCBI]

Partial

QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPAAFEDGSVNGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERSRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLDKLHLFPS

Approximately 32 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.