Hemojuvelin Protein, Cynomolgus (sf9, His)
The Hemojuvelin protein is a membrane-bound and soluble protein in mammals, also known as rejection directing Molecule C (RGMc) or hemochromatosis type 2 protein (HFE2). Hemojuvelin works by inhibiting the MAPK-JNK pathway that inhibits the growth, adhesion, migration, and invasion of prostate cancer cells. Hemojuvelin Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived Hemojuvelin protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Cynomolgus
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Hemojuvelin protein is a membrane-bound and soluble protein in mammals, also known as rejection directing Molecule C (RGMc) or hemochromatosis type 2 protein (HFE2). Hemojuvelin works by inhibiting the MAPK-JNK pathway that inhibits the growth, adhesion, migration, and invasion of prostate cancer cells. Hemojuvelin Protein, Cynomolgus (sf9, His) is the recombinant cynomolgus-derived Hemojuvelin protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Hemoglobinin (HJV), also known as rejection guide Molecule C (RGMc) or hemochromatosis type 2 protein (HFE2), is a membrane-binding and soluble protein in mammals that is responsible for the iron overload condition known as juvenile hemochromatosis in humans, which is a severe form of hemochromatosis. Hemojuvelin may play an inhibitory role by inhibiting the growth, adhesion, migration, and invasion of prostate cancer cells. In prostate and breast cancer cells, Hemojuvelin regulates both SMAD-dependent and SMAD-independent bone morphogenetic protein (BMP) signaling by inhibiting MAPK-JNK pathways[1][2][3].
Technical Parameters
-
Species Cynomolgus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
EHH15137 (Q36-S400)
-
Molecular Construction
-
N-term
-
Hemojuvelin (Q36-S400)
Accession # EHH15137 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
hemochromatosis type 2 (juvenile); hemojuvelin; hemojuvelin BMP co-receptor; HJV; RGM domain family member C
-
AA Sequence
QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPAAFEDGSVNGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERSRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLDKLHLFPS
-
Predicted Molecular Mass
40.2 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
