Hemopexin Protein, Cynomolgus (HEK293, His)
Hemopexin Protein binds to heme, transporting it to the liver for degradation and iron retrieval. After heme processing, Hemopexin returns to circulation, ready for another cycle of heme binding and transport. Hemopexin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Hemopexin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Hemopexin Protein binds to heme, transporting it to the liver for degradation and iron retrieval. After heme processing, Hemopexin returns to circulation, ready for another cycle of heme binding and transport. Hemopexin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Hemopexin protein, expressed by HEK293 , with C-His labeled tag.
Background
Hemopexin protein has the ability to bind to heme and facilitates its transportation to the liver for degradation and subsequent retrieval of iron. Once the heme is processed, the hemopexin molecule is released back into circulation, ready for another cycle of heme binding and transport.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5WVL1 (N24-Y462)
-
Molecular Construction
-
N-term
-
Hemopexin (N24-Y462)
Accession # A0A2K5WVL1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HPX; Epididymis Secretory Sperm Binding Protein; Hemopexin; HX; Beta-1B-Glycoprotein
-
AA Sequence
NPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWARELISETWKNFTSPVDAAFRHGHQSVFLIKGDKVWVYPPEKKEKGYPKLLQDKFPGIPSPLDAAVECHRGECQAEGILFFQGDHKWFWDLATGTMKKRYWSAVGNCSSALRWLGRYYCFQGNQFLRFNPVTGEVPPRYPLDVRDYFMPCPGRGHGHRNGTGHGNGTHHGPEYMRCSPHLVLSALMSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSTVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGSPHGIILDSVDAAFVCPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCVEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKSPPQPQKVTSLLGCTY
-
Predicted Molecular Mass
50.3 kDa
-
Molecular Weight
Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
