1. Recombinant Proteins
  2. Viral Proteins
  3. Hendra virus Glycoprotein/GP Protein (HEK293, His)

Hendra virus Glycoprotein/GP Protein (HEK293, His)

Cat. No.: HY-P704656
Handling Instructions Technical Support

The Hendra virus Glycoprotein/GP initiates infection by binding the virus to sialic acid-containing cell receptors. Upon binding, GP induces a conformational change, triggering fusion between the virion and cell membranes by the F protein. Hendra virus Glycoprotein/GP Protein (HEK293, His) is the recombinant virus-derived Hendra virus Glycoprotein/GP protein, expressed by HEK293, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Hendra virus Glycoprotein/GP initiates infection by binding the virus to sialic acid-containing cell receptors. Upon binding, GP induces a conformational change, triggering fusion between the virion and cell membranes by the F protein. Hendra virus Glycoprotein/GP Protein (HEK293, His) is the recombinant virus-derived Hendra virus Glycoprotein/GP protein, expressed by HEK293, with N-His labeled tag.

Background

The Hendra virus Glycoprotein/GP plays a pivotal role in initiating infection by attaching the virus to sialic acid-containing cell receptors. Upon binding to the receptor, glycoprotein G induces a conformational change that facilitates the triggering of fusion between virion and cell membranes by the F protein.

Species

Virus

Source

HEK293

Tag

N-His

Accession

O89343 (Q71-S604)

Gene ID

1446471

Molecular Construction
N-term
His
HeV GP (Q71-S604)
Accession # O89343
C-term
Protein Length

Virion surface

Synonyms
Hendra virus (HeV) (isolate Horse/Autralia/Hendra/1994) Glycoprotein Protein (Fc)
AA Sequence

QNYTRTTDNQALIKESLQSVQQQIKALTDKIGTEIGPKVSLIDTSSTITIPANIGLLGSKISQSTSSINENVNDKCKFTLPPLKIHECNISCPNPLPFREYRPISQGVSDLVGLPNQICLQKTTSTILKPRLISYTLPINTREGVCITDPLLAVDNGFFAYSHLEKIGSCTRGIAKQRIIGVGEVLDRGDKVPSMFMTNVWTPPNPSTIHHCSSTYHEDFYYTLCAVSHVGDPILNSTSWTESLSLIRLAVRPKSDSGDYNQKYIAITKVERGKYDKVMPYGPSGIKQGDTLYFPAVGFLPRTEFQYNDSNCPIIHCKYSKAENCRLSMGVNSKSHYILRSGLLKYNLSLGGDIILQFIEIADNRLTIGSPSKIYNSLGQPVFYQASYSWDTMIKLGDVDTVDPLRVQWRNNSVISRPGQSQCPRFNVCPEVCWEGTYNDAFLIDRLNWVSAGVYLNSNQTAENPVFAVFKDNEILYQVPLAEDDTNAQKTITDCFLLENVIWCISLVEIYDTGDSVIRPKLFAVKIPAQCSES

Predicted Molecular Mass
61.5 kDa.
Molecular Weight

Approximately 80-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in PBS, 0.3 M Arginine, pH7.3 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Hendra virus Glycoprotein/GP Protein (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Hendra virus Glycoprotein/GP Protein (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Hendra virus Glycoprotein/GP Protein (HEK293, His)
Cat. No.:
HY-P704656
Quantity:
MCE Japan Authorized Agent: