1. Recombinant Proteins
  2. Others
  3. Histone-H3 Protein, Xenopus laevis

Histone-H3 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone-H3, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Histone-H3 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone-H3, expressed by E. coli , with tag Free labeled tag.

Background

Histone H3 is an essential component of the nucleosome and plays a key role in the complex process of packaging and compacting DNA into chromatin, which in turn restricts access to DNA to cellular machinery that requires DNA as a template. This histone and its counterparts play critical roles in key cellular functions, including transcriptional regulation, DNA repair, DNA replication, and maintenance of chromosomal stability. Regulation of DNA accessibility involves a complex interplay of post-translational modifications, collectively known as the histone code, and dynamic remodeling of the nucleosome. The nucleosome itself comprises a histone octamer, composed of two molecules each of H2A, H2B, H3, and H4, assembled into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently packages approximately 147 base pairs of DNA, demonstrating its indispensable role in organizing chromatin structure and facilitating key genomic processes. In addition, histone H3 interacts with various cellular components, such as TONSL, CHAF1A, CHAF1B, MCM2, and DNAJC9, further contributing to its multifaceted functions.

Species

Xenopus laevis

Source

E. coli

Tag

Tag Free

Accession

A0A310TTQ1 (M1-A136)

Gene ID

108703785

Protein Length

Full Length

Synonyms
Histone H3; LOC121398065; LOC108703785; LOC121398067; Xenopus laevis; African clawed frog; DNA-binding
AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Predicted Molecular Mass
15.4 kDa
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Histone-H3 Protein, Xenopus laevis Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Histone-H3 Protein, Xenopus laevis

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Histone-H3 Protein, Xenopus laevis
Cat. No.:
HY-P703460
Quantity:
MCE Japan Authorized Agent: