Histone-H3 Protein, Xenopus laevis

Histone-H3 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone-H3, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.
  • Species: Xenopus laevis
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Histone-H3 Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone-H3, expressed by E. coli , with tag Free labeled tag.

Background

Histone H3 is an essential component of the nucleosome and plays a key role in the complex process of packaging and compacting DNA into chromatin, which in turn restricts access to DNA to cellular machinery that requires DNA as a template. This histone and its counterparts play critical roles in key cellular functions, including transcriptional regulation, DNA repair, DNA replication, and maintenance of chromosomal stability. Regulation of DNA accessibility involves a complex interplay of post-translational modifications, collectively known as the histone code, and dynamic remodeling of the nucleosome. The nucleosome itself comprises a histone octamer, composed of two molecules each of H2A, H2B, H3, and H4, assembled into one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently packages approximately 147 base pairs of DNA, demonstrating its indispensable role in organizing chromatin structure and facilitating key genomic processes. In addition, histone H3 interacts with various cellular components, such as TONSL, CHAF1A, CHAF1B, MCM2, and DNAJC9, further contributing to its multifaceted functions.

Technical Parameters

  • Species Xenopus laevis
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    Histone H3; LOC121398065; LOC108703785; LOC121398067

  • AA Sequence

    MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

  • Predicted Molecular Mass

    15.4 kDa

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00