HLA-C Protein, Human (His)
Based on 1 Customer Validation
HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli, with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli, with N-6*His labeled tag.
Background
HLA-C protein is a member of the major histocompatibility complex (MHC) class I family, placing it within a group of proteins that play crucial roles in the immune system by presenting antigens to cytotoxic T cells. As a part of the MHC class I family, HLA-C is involved in the regulation of immune responses and the recognition of foreign substances. Further exploration is necessary to uncover the specific functions and implications of HLA-C within the broader context of the MHC class I family, shedding light on its significance in immune surveillance and host defense mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O78179 (C25-I308)
-
Gene ID3107
-
Molecular Construction
-
N-term
-
6*His
-
HLA-C (C25-I308)
Accession # O78179 -
C-term
-
-
Protein Length
Partial
-
Synonyms
HLA-C protein; MHC class I antigen; HLA-C
-
AA Sequence
CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI
-
Predicted Molecular Mass
36.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)