HLA-C Protein, Human (His)

Customer Review

Based on 1 Customer Validation

HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli, with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

HLA-C Protein, part of the MHC class I family, is crucial for immune system functions, presenting antigens to cytotoxic T cells. In this family, HLA-C is involved in regulating immune responses and recognizing foreign substances. Further exploration is needed to reveal specific functions and implications within the broader MHC class I family, emphasizing its significance in immune surveillance and host defense mechanisms. HLA-C, Human (His) is the recombinant human-derived HLA-C protein, expressed by E. coli, with N-6*His labeled tag.

Background

HLA-C protein is a member of the major histocompatibility complex (MHC) class I family, placing it within a group of proteins that play crucial roles in the immune system by presenting antigens to cytotoxic T cells. As a part of the MHC class I family, HLA-C is involved in the regulation of immune responses and the recognition of foreign substances. Further exploration is necessary to uncover the specific functions and implications of HLA-C within the broader context of the MHC class I family, shedding light on its significance in immune surveillance and host defense mechanisms.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • HLA-C (C25-I308)
      Accession # O78179
    • C-term
  • Protein Length

    Partial

  • Synonyms

    HLA-C protein; MHC class I antigen; HLA-C

  • AA Sequence

    CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI

  • Predicted Molecular Mass

    36.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00