1. Recombinant Proteins
  2. Others
  3. HOXA1 Protein, Human (His)

The HOXA1 protein is a sequence-specific transcription factor that complexly regulates multiple developmental processes in the brainstem, inner and outer ears, abducens nerves, and cardiovascular development. It also plays a key role in cognitive and behavioral processes. HOXA1 Protein, Human (His) is the recombinant human-derived HOXA1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HOXA1 protein is a sequence-specific transcription factor that complexly regulates multiple developmental processes in the brainstem, inner and outer ears, abducens nerves, and cardiovascular development. It also plays a key role in cognitive and behavioral processes. HOXA1 Protein, Human (His) is the recombinant human-derived HOXA1 protein, expressed by E. coli , with N-His labeled tag.

Background

HOXA1 protein functions as a sequence-specific transcription factor, intricately regulating diverse developmental processes encompassing the brainstem, inner and outer ear, abducens nerve, and cardiovascular development. Additionally, it plays a pivotal role in cognitive and behavioral processes. Integral to a developmental regulatory system that imparts specific positional identities along the anterior-posterior axis, HOXA1 primarily influences anterior body structures and contributes to the maintenance or generation of hindbrain segments. Its transcriptional activation is contingent upon the presence of PBX1A and PKNOX1. In the nucleus, HOXA1 interacts with OGT via the TPR repeats domain. Furthermore, it forms a DNA-binding heterodimer with the transcription factor PBX1, highlighting its multifaceted role in orchestrating intricate developmental programs.

Species

Human

Source

E. coli

Tag

N-His

Accession

P49639-1 (M1-H335)

Gene ID
Molecular Construction
N-term
His
HOXA1 (M1-H335)
Accession # P49639-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Homeobox protein Hox-A1; HOXA1; HOX1F
AA Sequence

MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHRHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH

Molecular Weight

Approximately 42 kDa

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution in 50 mM Tris, 30% Glycerol, pH 7.5 or 20 mM MES, 1 M Urea, 300 mM NaCl, 1 mM DTT, pH 6.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

HOXA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HOXA1 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HOXA1 Protein, Human (His)
Cat. No.:
HY-P74879
Quantity:
MCE Japan Authorized Agent: