HOXA1 Protein, Human (His)
Based on 1 Customer Validation
The HOXA1 protein is a sequence-specific transcription factor that complexly regulates multiple developmental processes in the brainstem, inner and outer ears, abducens nerves, and cardiovascular development. It also plays a key role in cognitive and behavioral processes. HOXA1 Protein, Human (His) is the recombinant human-derived HOXA1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The HOXA1 protein is a sequence-specific transcription factor that complexly regulates multiple developmental processes in the brainstem, inner and outer ears, abducens nerves, and cardiovascular development. It also plays a key role in cognitive and behavioral processes. HOXA1 Protein, Human (His) is the recombinant human-derived HOXA1 protein, expressed by E. coli , with N-His labeled tag.
HOXA1 protein functions as a sequence-specific transcription factor, intricately regulating diverse developmental processes encompassing the brainstem, inner and outer ear, abducens nerve, and cardiovascular development. Additionally, it plays a pivotal role in cognitive and behavioral processes. Integral to a developmental regulatory system that imparts specific positional identities along the anterior-posterior axis, HOXA1 primarily influences anterior body structures and contributes to the maintenance or generation of hindbrain segments. Its transcriptional activation is contingent upon the presence of PBX1A and PKNOX1. In the nucleus, HOXA1 interacts with OGT via the TPR repeats domain. Furthermore, it forms a DNA-binding heterodimer with the transcription factor PBX1, highlighting its multifaceted role in orchestrating intricate developmental programs.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P49639-1 (M1-H335)
-
Molecular Construction
-
N-term
-
His
-
HOXA1 (M1-H335)
Accession # P49639-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
HOXA1; Homeobox Protein Hox-1F; Prev. HOX1F; Hox 1.6-Like Protein; Prev. HOX1; Lab-Like Protein; Homeo Box A1; Homeobox 1F; Homeobox Protein Hox-A1; BSAS; Homeobox A1; HOX A1 Homeodomain Protein
-
AA Sequence
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHRHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
-
Predicted Molecular Mass
38 kDa
-
Molecular Weight
Approximately 42 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution in 50 mM Tris, 30% Glycerol, pH 7.5 or 20 mM MES, 1 M Urea, 300 mM NaCl, 1 mM DTT, pH 6.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
