1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules T Cell CD Proteins
  4. ICOS/CD278
  5. ICOS Protein, Rat (C137S, C138S, HEK293, His)

ICOS Protein, Rat (C137S, C138S, HEK293, His)

Cat. No.: HY-P704668
Handling Instructions Technical Support

ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (C137S, C138S, HEK293, His) is the recombinant rat-derived ICOS protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (C137S, C138S, HEK293, His) is the recombinant rat-derived ICOS protein, expressed by HEK293, with C-His labeled tag.

Background

ICOS, an essential protein in T-cell function, significantly enhances various T-cell responses to foreign antigens. It plays a pivotal role in promoting T-cell proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and efficient assistance for B-cell antibody secretion. Notably, ICOS is indispensable for the normal antibody responses to T-cell dependent antigens, fostering the interaction between T and B-cells. Interestingly, ICOS does not elevate interleukin-2 production but superinduces the synthesis of interleukin-10. Additionally, it serves a crucial function in preventing the apoptosis of pre-activated T-cells and plays a significant role in CD40-mediated class switching of immunoglobulin isotypes. The protein forms homodimers through disulfide linkages, contributing to its multifaceted role in modulating immune responses.

Species

Rat

Source

HEK293

Tag

C-His

Accession

Q9R1T7-1 (E21-P145, C137S, C138S)

Gene ID

64545

Molecular Construction
N-term
ICOS (E21-P145, C137S, C138S)
Accession # Q9R1T7-1
His
C-term
Protein Length

Extracellular Domain

Synonyms
Inducible T-cell costimulator; CD278; AILIM; CVID1; ICOS
AA Sequence

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLSSQLKLWLP

Predicted Molecular Mass
15.9 kDa.
Molecular Weight

Approximately 24-26 kDa and 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ICOS Protein, Rat (C137S, C138S, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ICOS Protein, Rat (C137S, C138S, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ICOS Protein, Rat (C137S, C138S, HEK293, His)
Cat. No.:
HY-P704668
Quantity:
MCE Japan Authorized Agent: