ICOS Protein, Rat (C137S, C138S, HEK293, His)
ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (C137S, C138S, HEK293, His) is the recombinant rat-derived ICOS protein, expressed by HEK293, with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ICOS is a key protein for T cell function and can significantly enhance various T cell responses to foreign antigens. It plays a crucial role in promoting T cell proliferation, lymphokine secretion and upregulation of intercellular interaction molecules, and promoting efficient secretion of B cell antibodies. ICOS Protein, Rat (C137S, C138S, HEK293, His) is the recombinant rat-derived ICOS protein, expressed by HEK293, with C-His labeled tag.
Background
ICOS, an essential protein in T-cell function, significantly enhances various T-cell responses to foreign antigens. It plays a pivotal role in promoting T-cell proliferation, secretion of lymphokines, up-regulation of cell-cell interaction molecules, and efficient assistance for B-cell antibody secretion. Notably, ICOS is indispensable for the normal antibody responses to T-cell dependent antigens, fostering the interaction between T and B-cells. Interestingly, ICOS does not elevate interleukin-2 production but superinduces the synthesis of interleukin-10. Additionally, it serves a crucial function in preventing the apoptosis of pre-activated T-cells and plays a significant role in CD40-mediated class switching of immunoglobulin isotypes. The protein forms homodimers through disulfide linkages, contributing to its multifaceted role in modulating immune responses.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
Q9R1T7-1 (E21-P145, C137S, C138S)
-
Gene ID64545
-
Molecular Construction
-
N-term
-
ICOS (E21-P145, C137S, C138S)
Accession # Q9R1T7-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ICOS; CD278; Inducible T Cell Costimulator; Inducible T-Cell Co-Stimulator; Activation-Inducible Lymphocyte Immunomediatory Molecule; Inducible Costimulator; Inducible T-Cell Costimulator; CD278 Antigen; AILIM; CVID1
-
AA Sequence
ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLSSQLKLWLP
-
Predicted Molecular Mass
16.1 kDa
-
Molecular Weight
Approximately 24-26 kDa & 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
