IdeS Protein, Streptococcus pyogenes (His, solution)

IdeS Protein is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can degrade IgG and participate in the immune response.IdeS Protein inhibits the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity. IdeS Protein, Streptococcus pyogenes (His, solution) is the recombinant IdeS protein, expressed by E.coli , with N-10*His labeled tag.

IdeS is a highly specific IgG endopeptidase evolved from Streptococcus pyogenes, which can not only degrade IgG but also directly or indirectly inhibit the innate immune response, thus promoting the survival of streptococcus in the inflammatory environment. IdeS was found to be identical to Mac-1 in Streptococcus, a protein thought to inhibit phagocytosis by inhibiting the recognition of IgG and/or complement configurations by the Fc receptor (CD16). IdeS/Mac-1 can inhibit the function of certain neutrophil effectors, namely the production of reactive oxygen species (ROS), independently of IgG endopeptidase activity^[1][2].

One unit digests ≥ 95% of 1µg human IgG when incubated in PBS buffer, pH 7.4 at 37°C for 30min. The specific activity is 20,000 unit/mg.

Others

E. coli

N-10*His

F8V4V0 (D30-N341)

/

Full Length of Mature Protein

DSFSANQEIRYSEVTPYHVTSVWTKGVTPPAKFTQGEDVFHAPYVANQGWYDITKTFNGKDDLLCGAATAGNMLHWWFDQNKEKIEAYLKKHPDKQKIMFGDQELLDVRKVINTKGDQTNSELFNYFRDKAFPGLSARRIGVMPDLVLDMFINGYYLNVYKTQTTDVNRTYQEKDRRGGIFDAVFTRGDQSKLLTSRHDFKEKNLKEISDLIKKELTEGKALGLSHTYANVRINHVINLWGADFDSNGNLKAIYVTDSDSNASIGMKKYFVGVNSAGKVAISAKEIKEDNIGAQVLGLFTLSTGQDSWNQTN

Approximately 34 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 50% Glycerol, pH 6.6.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.